DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14826 and CG34444

DIOPT Version :9

Sequence 1:NP_001097528.2 Gene:CG14826 / 38791 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097313.1 Gene:CG34444 / 5740745 FlyBaseID:FBgn0085473 Length:295 Species:Drosophila melanogaster


Alignment Length:281 Identity:57/281 - (20%)
Similarity:87/281 - (30%) Gaps:111/281 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FMGHRQKRWLIYQNSGSLKFSIGPSMPIPLGDKVTFRSCVLSYTLQGGSYSLPTSPIWPWDK--- 90
            |..:.|::: ::...|:....:..::|:.|    .|....|||..: .||.||.|    |.:   
  Fly    15 FFRNSQEKF-VWCTGGASSLFVAIALPLDL----RFEKAFLSYNFE-VSYDLPRS----WKQKPP 69

  Fly    91 ----WEGTFARSLM---------------------QMRRNIERHVAN---------------GGV 115
                ..||...||:                     |...|..:|..:               |.|
  Fly    70 FLRHGNGTNDESLLSDHHGHHQNDDFVYDDYYDDDQNSGNKHKHKHHPHHHDKKKKKSKPKPGSV 134

  Fly   116 -----------------------------RYADDARLLVYTALEEYMGRRNNDRSM--------- 142
                                         .|.|..:......:.|.:||....||:         
  Fly   135 IKPQKNKPKHKHKKKHKSKPKPPPEVDEDDYKDFFQGFPLDGMGESVGRDRQSRSLLSRTKFYYI 199

  Fly   143 ------------GRQCLLRSICE--NAQIHHHIGVFSEIMDIVLSPGKA---DLDNDYHDAYAAG 190
                        |..||||.|||  :.|:....||...::.::.||..:   :|...|:.|...|
  Fly   200 INHRFELHGLGAGDSCLLRLICEANSYQLGDLNGVLGSLIHVMFSPSSSRYEELPKRYYIAELDG 264

  Fly   191 RAGANCLGLYSACPRGHNFLD 211
            |.| ||.|....|.  |:.||
  Fly   265 RNG-NCGGYRVQCE--HSVLD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 31/118 (26%)
CG34444NP_001097313.1 DM4_12 193..276 CDD:285126 22/83 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452578
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.