DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14826 and CG34442

DIOPT Version :9

Sequence 1:NP_001097528.2 Gene:CG14826 / 38791 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097311.1 Gene:CG34442 / 5740603 FlyBaseID:FBgn0085471 Length:245 Species:Drosophila melanogaster


Alignment Length:196 Identity:44/196 - (22%)
Similarity:68/196 - (34%) Gaps:35/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KFSIGPSMPIPLGDKVTFRSCVLSYTLQGGSYS----LPTSPIWPWDKWEGTFARSLMQMRRNIE 107
            ::.|..::.:|:|  :..|:..|||..:...|.    ....||.....:|.::.......|....
  Fly    34 EYGIFMAISVPIG--LPHRNVFLSYNYEFNYYQPEHVYKYPPILMGQDFEDSYLTYPTTGREAEG 96

  Fly   108 RHVAN-------GGVRYADDARLLVYTALEEYMGRRNNDRSM---------------GRQCLLRS 150
            ||..|       |.:............|..|..|.....||:               ...||||.
  Fly    97 RHCQNCTDWKIEGNINSTSSNNNSTKAASREKRGLTLMSRSVFYAMLRDKLRRSGFPAEPCLLRL 161

  Fly   151 ICEN--AQIHHHIGVFSEIMDIVLSPGKA---DLDNDYHDAYAAGRAGANCLGLYSACPRGHNFL 210
            ||:.  :|:....|....::.|:.||..:   .|.|:|:.|...||....|.....:|  .||.|
  Fly   162 ICDTNASQLGEVNGFLGSLVHIIFSPSSSKDEHLPNEYYQAEWDGREQQECSTYTKSC--DHNIL 224

  Fly   211 D 211
            |
  Fly   225 D 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 26/112 (23%)
CG34442NP_001097311.1 DM4_12 136..219 CDD:285126 20/82 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.