DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14826 and CG34443

DIOPT Version :9

Sequence 1:NP_001097528.2 Gene:CG14826 / 38791 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097312.1 Gene:CG34443 / 5740580 FlyBaseID:FBgn0085472 Length:239 Species:Drosophila melanogaster


Alignment Length:210 Identity:49/210 - (23%)
Similarity:81/210 - (38%) Gaps:47/210 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SGSLKFSIGPSMPIPLGDKVTFRSCVLSYTLQGGSYSLPTSPIWPWDKW----------EGTFAR 97
            :.|....|..::.:||  ::..|:..:||..: .:|:||.:    |:||          |.....
  Fly    28 TASSTHGIFAAIAVPL--ELPHRNVFVSYNFE-ANYNLPAN----WEKWTIFQNGPIESEEVVDE 85

  Fly    98 SLMQMRRNIERHVANGGVRYADDARLLVYTALEEYMGRRNNDRSM-------------------- 142
            :..:..|.:.....|..|:..::|.......:.|.:.:....||:                    
  Fly    86 TDTETDRKLAAGCQNCTVKEENEAGSEEVEEITEVLPQERKVRSLLTRSNIYRIFVDKLKRSGFR 150

  Fly   143 GRQCLLRSICEN--AQIHHHIGVFSEIMDIVLSPGKA---DLDNDYHDAYAAGRAGANCLGLYSA 202
            |..||||.|||.  ||:....||...:|.::.||..:   ||...|:.|...|..| :|......
  Fly   151 GESCLLRLICETSAAQLDEFNGVLGSLMHVLFSPSSSESEDLPLRYYQAEHDGWNG-HCHVYEPG 214

  Fly   203 CPRGHNFLDGLLIVE 217
            |  |.:.|:  ||.|
  Fly   215 C--GESILE--LISE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 28/117 (24%)
CG34443NP_001097312.1 DM4_12 133..215 CDD:285126 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452583
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.