DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14826 and CG42812

DIOPT Version :9

Sequence 1:NP_001097528.2 Gene:CG14826 / 38791 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097901.2 Gene:CG42812 / 50072 FlyBaseID:FBgn0261994 Length:217 Species:Drosophila melanogaster


Alignment Length:239 Identity:62/239 - (25%)
Similarity:93/239 - (38%) Gaps:66/239 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WTTGLLLAVAMLSLPSRGDSSRNLTEFMGHRQKRWLIYQNSGSLKFSIGPSMPIPLGDKVTFRSC 67
            |.|..:|.:                 |:.| |...|::..|.:|..::  |:..|:.:....|..
  Fly     5 WLTTCILVI-----------------FLIH-QSSSLLWPASSNLGLTL--SVSTPIAELYPERRI 49

  Fly    68 VLSYTLQGGSYSLP-------TSPIWPWDKWEGTFA-----RSLMQMRRNIER------HVANGG 114
            ::.:.. ..||:.|       :.||||      .||     |.:.|:....|.      |....|
  Fly    50 LIDWCF-AISYNYPYNLTEFYSIPIWP------GFANYKAKREVPQLEMTDENFYTKYGHDNGNG 107

  Fly   115 VRYADDARLLVYTALEEYMGRRNNDRSMGRQCLLRSICENAQ-----IHHHIGVFSEIMDIVLSP 174
            :...|.:...:|..||:.:    ........|||||:||.||     .|.|:  .|:|:..||||
  Fly   108 MHPKDFSAGELYAFLEDTL----TGYGFHETCLLRSVCELAQHPFDDSHQHL--LSDIVTFVLSP 166

  Fly   175 ----GKADLDNDYHDAYAA----GRAGANCLGLYSACPRGHNFL 210
                |..|.::.|..||..    |..|.:||.|||.|.  |:.|
  Fly   167 SQHEGFRDDEDVYRKAYELAEQDGFLGRDCLRLYSHCK--HDIL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 35/105 (33%)
CG42812NP_001097901.2 DM4_12 110..210 CDD:214785 36/107 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.