DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14826 and CG5768

DIOPT Version :9

Sequence 1:NP_001097528.2 Gene:CG14826 / 38791 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001369031.1 Gene:CG5768 / 42915 FlyBaseID:FBgn0039198 Length:397 Species:Drosophila melanogaster


Alignment Length:210 Identity:45/210 - (21%)
Similarity:72/210 - (34%) Gaps:66/210 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RQKRWLIYQNSGSLKFSIGPSMPIPLGDKVTFRSCVLSYTLQGGSYSLPTSPIWPWDKWEGTFA- 96
            |.||:|.:....|...::..::.|.......:.|..|::   |.:|.||.: .|......| || 
  Fly   217 RPKRYLSFPEGSSFSVAVCFTVGIIGNPYYGYNSFGLNW---GVAYDLPNT-TWVLQHLHG-FAT 276

  Fly    97 ----------RSLMQMRRNIERHVANGGVRYADDARLLVYTALEEYMGRRNNDRSMGRQCLLRSI 151
                      ||...:.|.||..|.|.|..                          ||.|:||::
  Fly   277 HPVAPAVLRRRSRSAIYRQIEAVVDNMGYN--------------------------GRDCILRTL 315

  Fly   152 CENAQIHHH--IGVFSEIMDIVLSPGK-----------ADL---DNDYHDAYAAGRAGANC---- 196
            ||:.|....  :.:..|::..:.|..|           ||:   |..|.:|:.......||    
  Fly   316 CESRQYFQRTKMSMVGEMLRTIFSLPKQRIFTRELHENADIVHYDQAYRNAHTDDCTQYNCHFSL 380

  Fly   197 ----LGLYSACPRGH 207
                .|.|:..|:.:
  Fly   381 LELAFGKYTTPPKNY 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 21/115 (18%)
CG5768NP_001369031.1 DM4_12 286..383 CDD:214785 26/122 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452666
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.