DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14826 and CG17780

DIOPT Version :9

Sequence 1:NP_001097528.2 Gene:CG14826 / 38791 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster


Alignment Length:130 Identity:29/130 - (22%)
Similarity:48/130 - (36%) Gaps:29/130 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 TFARSLMQMRRNIERHVANG------GVRYADDARLLV-----------YTALEEYMGRRNNDRS 141
            |:..|.::.|.|.:.:|...      |..:..:..:||           |..|.|.:.|...|  
  Fly   213 TYINSPLKFRVNAKNNVIKSPIVWAHGYGFRANTPVLVKRENRPFRRDTYELLHELIDRSGLD-- 275

  Fly   142 MGRQCLLRSICENAQIHHHIGVFSEIMDIVLSPGKADLDNDYHD-AYAAGRAGANCLG-LYSACP 204
             ||.|:|::.|......|..|...:::..|.:       .|.|| .:.......||.. ::|.||
  Fly   276 -GRACVLKAYCTALAGDHGQGFLFKLLKYVFT-------LDEHDKRHMPHLREENCEQIMHSHCP 332

  Fly   205  204
              Fly   333  332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 23/101 (23%)
CG17780NP_732995.1 DM4_12 136..>188 CDD:285126
DM4_12 253..338 CDD:214785 21/90 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.