DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14826 and CG17782

DIOPT Version :9

Sequence 1:NP_001097528.2 Gene:CG14826 / 38791 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_651257.1 Gene:CG17782 / 42912 FlyBaseID:FBgn0039195 Length:479 Species:Drosophila melanogaster


Alignment Length:97 Identity:29/97 - (29%)
Similarity:51/97 - (52%) Gaps:12/97 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 VRYADDARLLVYTALEEYMGRRNNDRSMGRQCLLRSICENAQ--IHHHIGVF-SEIMDIVLSPGK 176
            :::...:|..:|..:|:|:.:|.:.   |..|:||::||..|  ..|..|.| .|:|..|.:..:
  Fly   376 IKHHRRSRQSLYERIEKYLDKRGHH---GHHCVLRTLCETGQKSTEHEPGTFVGELMRAVFTLPE 437

  Fly   177 ADLDND---YHDAY--AAGRAGANCLGLYSAC 203
            | :||:   |.|::  .|..:.|:|..||..|
  Fly   438 A-MDNEPVAYRDSHYDKAHASKADCAVLYPEC 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 29/95 (31%)
CG17782NP_651257.1 DM4_12 378..475 CDD:214785 29/95 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452680
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.