DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14826 and CG17784

DIOPT Version :9

Sequence 1:NP_001097528.2 Gene:CG14826 / 38791 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_651254.1 Gene:CG17784 / 42909 FlyBaseID:FBgn0039192 Length:237 Species:Drosophila melanogaster


Alignment Length:190 Identity:65/190 - (34%)
Similarity:97/190 - (51%) Gaps:18/190 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PSRGDSSRNLTEFMGHRQKRWLIYQNSGSLKFSIGPSMPIPLGDKVTFRSCVLSYTLQGGSYSLP 81
            |...|:| :||..  .|.||..||...|.:|  :.||:..|:......:|....:.|||  ..:|
  Fly    46 PDESDNS-SLTSL--SRSKRVAIYNGQGVVK--LVPSLAYPVKQTDKEQSFWWFFNLQG--QWIP 103

  Fly    82 TS-PIWPWDKWEGT-FARSLMQMRRNIERHVANGGVRYADDARLLVYTALEEYMGRRNNDRSMGR 144
            |: |::.|..|..| |..:..:.|::::..|.:      |:||..||.|:|  :|....|.:.|.
  Fly   104 TTIPLYWWSFWNTTAFVSTAREWRKDMQAKVLH------DEARTWVYNAIE--VGMEQLDGAYGG 160

  Fly   145 QCLLRSICENAQ-IHHHIGVFSEIMDIVLSPGKADLDNDYHDAYAAGRAGANCLGLYSAC 203
            .||||||||.:| ...:..:||||::.||.|...::.:.|..|..|||.||:|...||.|
  Fly   161 VCLLRSICEISQKPFQNSNIFSEIVNAVLVPTLDNVASKYLHARDAGRGGADCERTYSDC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 37/88 (42%)
CG17784NP_651254.1 DM4_12 135..227 CDD:214785 37/94 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449133
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E2BX
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116663at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6482
65.850

Return to query results.
Submit another query.