DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14826 and CG14720

DIOPT Version :9

Sequence 1:NP_001097528.2 Gene:CG14826 / 38791 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_650108.2 Gene:CG14720 / 41415 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster


Alignment Length:212 Identity:59/212 - (27%)
Similarity:88/212 - (41%) Gaps:41/212 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SSRNLTEFMGH--RQKRWLIYQNSGSLKFSIGPSMPIPLGDKVTFRSCVLSYTLQGGSYSLPTSP 84
            |..:|....||  |..|.||:..:...:......:.||: :.:.|.|....|.|: ..|.|||:.
  Fly    12 SCMHLCSADGHLKRLSRSLIFPPTSPTRVQFIGGIGIPV-ENLHFESVTSGYVLK-AEYFLPTNS 74

  Fly    85 IWPWDKWEGTFARSLMQMRRNIERHVANGGVR----YADDARLLVYTALE---EYMGRRNNDRSM 142
                           .::.|...:.:|..|..    |....|.::|..:|   |.||      ..
  Fly    75 ---------------TEITRVYLKPMAITGREKESPYGALYRWIIYRGIEMVIENMG------LP 118

  Fly   143 GRQCLLRSICENA--QIHHHIGVFSEIMDIVLSPGKA------DLDNDYHDAYAAGRAGANCLGL 199
            ||.||||.|||:|  .::|..|:..|||:|||.|..:      ..|.:||.:...|:.|.:|...
  Fly   119 GRSCLLRLICEHAALPLNHESGLLGEIMNIVLRPSSSVDQLGQSSDREYHTSEHFGKRGGDCQAA 183

  Fly   200 Y-SACPRGHNFLDGLLI 215
            | |.|.:....|..||:
  Fly   184 YASRCKKSPMELISLLL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 35/104 (34%)
CG14720NP_650108.2 DM4_12 96..195 CDD:214785 35/104 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452650
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.