DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14826 and CG14829

DIOPT Version :9

Sequence 1:NP_001097528.2 Gene:CG14826 / 38791 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_648089.2 Gene:CG14829 / 38792 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster


Alignment Length:189 Identity:89/189 - (47%)
Similarity:127/189 - (67%) Gaps:8/189 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RNLTEFMGHRQKR-WLIYQNSGSLKFSIGPSMPIPLGDKVTFRSCVLSYTLQGGSYSLPTSPIWP 87
            :|:||:|..|||| .|||:|.|:::..:||.:...|.|.|.:||.|..|.|..|:::||::|::|
  Fly    30 QNITEYMHARQKRHQLIYRNGGTIRLVVGPVLSTQLEDPVVWRSLVYYYVLHFGAFTLPSAPLYP 94

  Fly    88 WDKWEGTFARSLMQMRRNIERHVANGGVRYADDARLLVYTALEEYMGRRNNDRSMGRQCLLRSIC 152
            |||||..:||||.:..|:::.       .:.||.||.||.|||.||.:.:.....||.||||.||
  Fly    95 WDKWETIYARSLQEKIRSLDE-------THEDDTRLFVYAALENYMDQVSGSPGRGRHCLLRGIC 152

  Fly   153 ENAQIHHHIGVFSEIMDIVLSPGKADLDNDYHDAYAAGRAGANCLGLYSACPRGHNFLD 211
            ||||:|||:|:.:|::.::|:|||..||..|.:|.|||:||.:||..||.||||.:.||
  Fly   153 ENAQVHHHVGIMAELLVVLLTPGKTRLDVAYKEALAAGQAGIDCLARYSDCPRGESVLD 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 49/92 (53%)
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 49/92 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449127
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I7423
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116663at50557
OrthoFinder 1 1.000 - - FOG0016578
OrthoInspector 1 1.000 - - mtm9573
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6482
88.000

Return to query results.
Submit another query.