DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14826 and CG13869

DIOPT Version :9

Sequence 1:NP_001097528.2 Gene:CG14826 / 38791 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster


Alignment Length:200 Identity:66/200 - (33%)
Similarity:102/200 - (51%) Gaps:29/200 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NLTEFMGH-RQKRWLIYQNSGSLKFSIGPSMPIPLGDKVTFRSCV--LSYTLQGGSYSLPTSPIW 86
            |||.:..| ||||:|||||.|.:||..|.:.|.|..:|..:|..|  :::..|   ::.|.:||:
  Fly    23 NLTSWRHHRRQKRFLIYQNGGVIKFVSGCAFPAPFMEKKAWRQLVWLMNFHYQ---FNEPQTPIY 84

  Fly    87 PWDKWEGTFARSLMQMRRNIERHVANGGV------RYADDARLLVYTALEEYMGRRNNDRSMGRQ 145
            .|..|:|:         ||::..:.....      ...|:.:||::...|.||.:...:   |..
  Fly    85 WWKLWDGS---------RNLKGPLTQPAPPSVPARLLVDEPQLLLFKFAEAYMNQLGQN---GSA 137

  Fly   146 CLLRSICENAQIHHHIGVFSEIMDIVLSPGKADLDNDYHDAYAAGRAGANCLGLYSACPRGHN-F 209
            ||.|.||||.|:..|.|::::::..:|.|.:. ||..|.|||..||.|.:|   .:|.|..|: .
  Fly   138 CLDRLICENGQVDEHSGLYAQLLHRLLRPHQT-LDVRYLDAYRMGRHGVDC---RNAFPEAHHCI 198

  Fly   210 LDGLL 214
            ||..|
  Fly   199 LDDYL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 32/93 (34%)
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 34/96 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449129
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E2BX
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116663at50557
OrthoFinder 1 1.000 - - FOG0016578
OrthoInspector 1 1.000 - - mtm9573
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.