DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and KIRREL3

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:XP_011541328.1 Gene:KIRREL3 / 84623 HGNCID:23204 Length:809 Species:Homo sapiens


Alignment Length:777 Identity:180/777 - (23%)
Similarity:283/777 - (36%) Gaps:192/777 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 GRQLPSSGRVEDTLVVPRVSRENRGMYQ---CVV----------RRPEGDTFQATAELQLGDAPP 423
            |..|..||.....|   |:.:...|:.:   |:|          |..||..:..:.:.|      
Human     6 GAGLRCSGIASSPL---RMQQNELGLQKRGCCLVLGYMAKDKFRRMNEGQVYSFSQQPQ------ 61

  Fly   424 VLLYSFIEQTLQPGPAVSLKCSAAGNPTPQ----ISWTLDGFPLPSNGRFMIG--QYITVHGDVI 482
                   :|.:..|..|:|.|:     .|:    :.|..||..| ..||.:..  ||:.| |:.:
Human    62 -------DQVVVSGQPVTLLCA-----IPEYDGFVLWIKDGLAL-GVGRDLSSYPQYLVV-GNHL 112

  Fly   483 S---HVNISHVMVEDGGEYACIAENRAGRVQHAARLNIYGLPYIRLI---PKVTAVSGETLNLKC 541
            |   |:.|....::|...|.|.|...|.| ...|||.:...|...:|   |.::..:|:.|||.|
Human   113 SGEHHLKILRAELQDDAVYECQAIQAAIR-SRPARLTVLVPPDDPVILGGPVISLRAGDPLNLTC 176

  Fly   542 PV-AGYPIEEIHWERGGRE----------LPDDIRQRVQPDGSLTISPVQKNSDSGVYTCWARNK 595
            .. ...|...|.|.|.|..          |.|..|:.:.  .:|.|||....:...: .|.|.||
Human   177 HADNAKPAASIIWLRKGEVINGATYSKTLLRDGKRESIV--STLFISPGDVENGQSI-VCRATNK 238

  Fly   596 QGHSARRSGEVTVIV--PP--KLSPFQTNILQLNMGDRASLTCSVVKGDLPLTINWRKDGRPIDP 656
            .....:.: .||:.:  ||  .||.....:|:.|:   .:..||...........|.|.|:.|..
Human   239 AIPGGKET-SVTIDIQHPPLVNLSVEPQPVLEDNV---VTFHCSAKANPAVTQYRWAKRGQIIKE 299

  Fly   657 TQHMSVKQVDQYNSILVIENLGSDHTGNY-----SCVVRNSAAEVENSQALLVNVPPRWIVEPVD 716
            ...      :.|.:.:       |:|  |     ||.|.|:......|:.:.|...||...||..
Human   300 ASG------EVYRTTV-------DYT--YFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQS 349

  Fly   717 ANVERNRHIMLHCQAQGVPTPSIVW-KKATGSKSGEYEEVRERPFTKLLGNGSLLLQHVKEDREG 780
            ..|:.....:..|...|.|:.:||| |:.:|              ..|....:|.|:.|:::..|
Human   350 LLVDLGSDAIFSCAWTGNPSLTIVWMKRGSG--------------VVLSNEKTLTLKSVRQEDAG 400

  Fly   781 FYLCQA-NNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAV-SGDKPINIVWMRSG 843
            .|:|:| ...:|.| .:.:.|.||..|..||| ::.....|:...::|.: |...|..|.|... 
Human   401 KYVCRAVVPRVGAG-EREVTLTVNGPPIISST-QTQHALHGEKGQIKCFIRSTPPPDRIAWSWK- 462

  Fly   844 KNTLNPSTNYKISVKQEATPDGVSAELQIRTVDATD-SGPYFCRASNLYGNDQQLVQLQVQEPPL 907
            :|.|...|:.:.:|:..:|.:||.:.|.|..:...| ...|.|.|.|.:|:|.::::|:.|...:
Human   463 ENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEM 527

  Fly   908 PPS-------------------------VLEAAMI------SSRSVNIKWQPKTLGT-------- 933
            ...                         ||.|.::      |.||...:......||        
Human   528 KSGAGLEAESVPMAVIIGVAVGAGVAFLVLMATIVAFCCARSQRSTGGRSGISGRGTEKKARLRL 592

  Fly   934 -------------GDVTKYIVEFREA------DHSLPPALFVDQWQ--------QIEV--KDPPH 969
                         .|:...||....|      :||....|.:|:.:        |:||  ::...
Human   593 PRRANLKGVVSAKNDIRVEIVHKEPASGREGEEHSTIKQLMMDRGEFQQDSVLKQLEVLKEEEKE 657

  Fly   970 FNAMIENLKPATR--YAFRVIAEGSAGRSAPSQELIVRTEPQRPAGP---PLSLSARPLSST 1026
            |    :|||..|.  |:.....|   ..|.|:..|.......||||.   |..:|...:.||
Human   658 F----QNLKDPTNGYYSVNTFKE---HHSTPTISLSSCQPDLRPAGKQRVPTGMSFTNIYST 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352 12/58 (21%)
IGc2 344..407 CDD:197706 10/47 (21%)
IG_like 432..517 CDD:214653 28/93 (30%)
IGc2 436..507 CDD:197706 22/79 (28%)
I-set 521..610 CDD:254352 26/102 (25%)
IGc2 533..597 CDD:197706 21/74 (28%)
Ig 630..699 CDD:143165 14/73 (19%)
IG_like 714..802 CDD:214653 21/89 (24%)
Ig 725..802 CDD:299845 19/78 (24%)
Ig 823..894 CDD:143165 20/72 (28%)
FN3 906..1006 CDD:238020 29/169 (17%)
FN3 1013..1111 CDD:238020 5/17 (29%)
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845 29/111 (26%)
IG_like 60..149 CDD:214653 29/109 (27%)
I-set 156..249 CDD:254352 23/96 (24%)
Ig2_KIRREL3-like 171..252 CDD:143236 22/84 (26%)
Ig_2 260..337 CDD:290606 19/94 (20%)
I-set 341..422 CDD:254352 24/95 (25%)
IGc2 355..406 CDD:197706 15/64 (23%)
Ig5_KIRREL3 424..521 CDD:143306 26/98 (27%)
IG_like 432..521 CDD:214653 22/89 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.