DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and Vsig10l

DIOPT Version :10

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_001355810.1 Gene:Vsig10l / 75690 MGIID:1922940 Length:868 Species:Mus musculus


Alignment Length:661 Identity:161/661 - (24%)
Similarity:240/661 - (36%) Gaps:173/661 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 FTHNGAGPLPVLSGPRVRL-LGPI----------------------------------------L 295
            |.....|||.||.|..:|| |.|:                                        |
Mouse   178 FPQQVGGPLAVLVGTTIRLPLTPVPSSSPPAPLVVWRRGSKVLAAGGLGSQAPLISLDPMHQARL 242

  Fly   296 AIEAVTG---------EDSGVYKCTAGNVGGEASAELR---LTVATPI-QVEISPNVLSVHMGGT 347
            ..:.:.|         :|:|||  |...:.|..|.::|   :.|..|: |:.:.|...... .|.
Mouse   243 RFDQIRGGLELTSARLDDAGVY--TVEVIRGGVSQQIREFVVGVFEPLPQLSVQPRAPETE-EGA 304

  Fly   348 AEFR--CLVTSNGSPVGMQNILWYKDGRQLPSSG---------RVE-DTLVVPRVSRENRGMYQC 400
            ||.|  |:    |...|...:.|.:|||.|.:|.         |.| |.|::.|..|.:...|.|
Mouse   305 AELRLSCV----GWNPGSGKLSWSRDGRALGTSDPEGAEPPRIRTERDQLLISRPVRSDHARYTC 365

  Fly   401 VVRRPEGDTFQATAELQL---GDAPPVLLYSFIEQTLQP------GPAVSLKCSAAGNPTPQISW 456
            .||.|.|.| :|.|::.:   .|||.:.:.|  ::...|      |..|:|.|||...|...|:|
Mouse   366 QVRSPFGHT-EAAADVSVFYGPDAPVIRVSS--DRDASPALYVTAGSNVTLHCSAPSRPPADIAW 427

  Fly   457 TLDGFPLPSNGRFMIGQYITVHGDVISHVNISHVMVEDGGEYACIAEN-RAGRVQHAARLNIYGL 520
            :|..   |:......|..:     ::..|...|     ||.|||||.| |.|.    .|.:::.|
Mouse   428 SLAD---PTEAAVPAGPRL-----LLPAVGPGH-----GGAYACIAANPRTGH----RRRSVFNL 475

  Fly   521 PYIRLIPKVTAVSGETLNLKCPVAGYPIE-----EIHWERGG--------RELPDDIRQRVQPDG 572
            ....|.|...         :|.|.|.|::     ...|. ||        :.||:.:|....|..
Mouse   476 TVADLPPGAP---------QCSVEGGPVDRSLRFRCSWP-GGVPAASLQFQGLPEGVRAGPVPST 530

  Fly   573 SLTISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIVP--PKLSPFQTNILQLNMGDRASLTCS 635
            .|...|.:........||.||:.   .|.|:   ..|:|  |:....|..:.:...|| ..:...
Mouse   531 LLVTVPARPELSGVAVTCLARHL---VATRT---CTIIPEAPQEVLLQPIVEETQPGD-VVVALE 588

  Fly   636 VVKGDLPLTINWRKDGRPIDPTQHMSVKQVDQYNSILVIENLGSD-HTGNYSCVVRNSAAEVENS 699
            |.....|...:|.:.|||:.|.....: |:.|....|:|.|...| ..|||| |:.:||.....:
Mouse   589 VTGCPPPSRASWARQGRPLAPGGGGRL-QLSQDGRKLLINNFSLDWDLGNYS-VLCSSALGAGGN 651

  Fly   700 QALLVNVP-PRWIVEPVDA------NVERNRHIM-LHCQAQGVPTPSIVWKKATGSKSGEYEEV- 755
            |..|.... ..|.::....      :|||...:. .|.||         |     :.|.|.:.| 
Mouse   652 QITLTGPSISSWRLQRAQEAAVLTWDVERGTLLTGFHIQA---------W-----TDSSEVDRVT 702

  Fly   756 RERPFTKLLGNGSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKG 820
            ..|.:..||..|       .::|.........|. ||...:::.: :.|.|...|.||   |.:.
Mouse   703 MSRDWVSLLILG-------PQERSAIVPLPPRNP-GTWAFRILPI-LGSLPGTPSQSR---VYQA 755

  Fly   821 DTALLQCAVSG 831
            .:.|...|::|
Mouse   756 GSDLSPGAIAG 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 30..128 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand E 86..90 CDD:409353
Ig strand F 106..111 CDD:409353
Ig strand G 119..123 CDD:409353
V-set 138..229 CDD:462230
Ig 238..327 CDD:472250 21/107 (20%)
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353 161/661 (24%)
Ig strand E 293..297 CDD:409353 2/43 (5%)
Ig strand F 307..312 CDD:409353 2/4 (50%)
Ig strand G 320..323 CDD:409353 1/2 (50%)
Ig 330..418 CDD:472250 31/100 (31%)
Ig strand B 348..352 CDD:409353 3/5 (60%)
Ig strand C 365..369 CDD:409353 0/3 (0%)
Ig strand E 383..387 CDD:409353 2/3 (67%)
Ig strand F 397..402 CDD:409353 2/4 (50%)
Ig strand G 411..414 CDD:409353 1/2 (50%)
IgI_4_Dscam 422..517 CDD:409548 28/101 (28%)
Ig strand A 422..425 CDD:409548 1/2 (50%)
Ig strand A' 431..435 CDD:409548 0/3 (0%)
Ig strand B 438..447 CDD:409548 4/8 (50%)
Ig strand C 452..458 CDD:409548 2/5 (40%)
Ig strand C' 460..463 CDD:409548 0/2 (0%)
Ig strand D 468..476 CDD:409548 1/7 (14%)
Ig strand E 480..489 CDD:409548 1/8 (13%)
Ig strand F 496..504 CDD:409548 6/7 (86%)
Ig strand G 507..517 CDD:409548 2/9 (22%)
IgI_5_Dscam 521..608 CDD:409550 21/99 (21%)
Ig strand A 521..523 CDD:409550 0/1 (0%)
Ig strand A' 528..532 CDD:409550 0/3 (0%)
Ig strand B 535..542 CDD:409550 0/6 (0%)
Ig strand C 549..555 CDD:409550 1/10 (10%)
Ig strand C' 556..558 CDD:409550 2/9 (22%)
Ig strand D 565..569 CDD:409550 1/3 (33%)
Ig strand E 572..578 CDD:409550 1/5 (20%)
Ig strand F 586..594 CDD:409550 3/7 (43%)
Ig strand G 598..608 CDD:409550 2/9 (22%)
Ig 611..704 CDD:472250 26/95 (27%)
Ig strand B 630..634 CDD:409353 0/3 (0%)
Ig strand C 644..648 CDD:409353 0/3 (0%)
Ig strand E 670..674 CDD:409353 1/3 (33%)
Ig strand F 684..689 CDD:409353 3/4 (75%)
Ig strand G 697..700 CDD:409353 0/2 (0%)
IgI_7_Dscam 707..802 CDD:409546 19/103 (18%)
Ig strand A 707..711 CDD:409546 0/4 (0%)
Ig strand A' 716..720 CDD:409546 0/9 (0%)
Ig strand B 723..732 CDD:409546 2/9 (22%)
Ig strand C 738..744 CDD:409546 1/5 (20%)
Ig strand C' 750..753 CDD:409546 1/2 (50%)
Ig strand D 761..764 CDD:409546 0/2 (0%)
Ig strand E 767..773 CDD:409546 1/5 (20%)
Ig strand F 780..788 CDD:409546 0/7 (0%)
Ig strand G 793..802 CDD:409546 0/8 (0%)
Ig 806..892 CDD:472250 8/26 (31%)
Ig strand B 823..827 CDD:409353 1/3 (33%)
Ig strand C 836..840 CDD:409353
Ig strand E 868..872 CDD:409353
Ig strand F 882..887 CDD:409353
FN3 <904..1195 CDD:442628
FN3 906..1006 CDD:238020
fn3 1221..1306 CDD:394996
Ig 1336..1396 CDD:409353
Ig strand B 1336..1340 CDD:409353
Ig strand E 1371..1375 CDD:409353
Ig strand F 1385..1390 CDD:409353
FN3 <1407..>1606 CDD:442628
fn3 1408..1491 CDD:394996
Vsig10lNP_001355810.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..82
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..154
Ig 307..377 CDD:409353 23/74 (31%)
Ig strand B 307..311 CDD:409353 1/3 (33%)
Ig strand C 320..324 CDD:409353 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 323..342 6/18 (33%)
Ig strand E 348..352 CDD:409353 2/3 (67%)
Ig strand F 362..367 CDD:409353 2/4 (50%)
Ig_2 388..477 CDD:464026 30/107 (28%)
Ig 577..640 CDD:472250 19/65 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.