DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and DIP-epsilon

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:425 Identity:101/425 - (23%)
Similarity:164/425 - (38%) Gaps:68/425 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   572 GSLTISPVQKNSDSGVYTCWARNKQGHSARRSGEV---TVIVPPKLSPFQTNILQLNMGDRASLT 633
            |.|..|.|..::|:|        .:|::....|..   .:...|:.:....|| .:..|....|.
  Fly    17 GCLIASSVALSTDTG--------SEGNAGNVGGSTLNNVISEDPEFTDVIENI-TVPAGRNVKLA 72

  Fly   634 CSVVKGDLPLTINWRKDGRPIDPTQHMSV-----------KQVDQYNS-ILVIENLGSDHTGNYS 686
            || ||......:.|....:....|.|..|           .:.|::.: .|.|.|:..:..|.|.
  Fly    73 CS-VKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYM 136

  Fly   687 CVVRNSAAEVENSQALLVNVPPRW--IVEPVDANVERNRHIMLHCQAQGVPTPSIVWKKATGSK- 748
            |.:....|:.:.....:| |||..  .:...|..|....::.|.|:|:|.|.|:|.||:..|:| 
  Fly   137 CQINTVTAKTQYGFVKVV-VPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKI 200

  Fly   749 -SGEYEEVRERPFTKLLGNGSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSPYFSSTS 812
             ..:..||.:      |...||.|:.:.....|.|||.|:||:...:.|.|::.|:.||......
  Fly   201 VINKTLEVHD------LETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPH 259

  Fly   813 RSVMVKKGDTALLQCAVSGDKPINIVWMRSGKNTLNPSTNYKISVKQEATPDGVS----AELQIR 873
            :.|.:..|....|:|.:..:......|.|.....:..|:.|    |.|..|...|    ..|.|.
  Fly   260 QLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKY----KTETIPGHPSYKATMRLTIT 320

  Fly   874 TVDATDSGPYFCRASNLYGNDQQLVQLQVQEPPL---PP----------SVLEAAM-------IS 918
            .|.::|.|.|.|.|.|..|:....::|.:..||.   ||          :..|.|:       ::
  Fly   321 NVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQPPPTTTTLRRTTTTAAEIALDGYINTPLN 385

  Fly   919 SRSVNIKWQPKT---LGTGDVT-KYIVEFREADHS 949
            ...:.|..:..|   :.:|..: ||:....|.|.|
  Fly   386 GNGIGIVGEGPTNSVIASGKSSIKYLSNLNEIDKS 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653
IGc2 436..507 CDD:197706
I-set 521..610 CDD:254352 8/40 (20%)
IGc2 533..597 CDD:197706 6/24 (25%)
Ig 630..699 CDD:143165 17/80 (21%)
IG_like 714..802 CDD:214653 28/89 (31%)
Ig 725..802 CDD:299845 26/78 (33%)
Ig 823..894 CDD:143165 20/74 (27%)
FN3 906..1006 CDD:238020 13/68 (19%)
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 21/98 (21%)
Ig 69..139 CDD:143165 16/70 (23%)
IG_like 165..249 CDD:214653 28/89 (31%)
IGc2 172..237 CDD:197706 23/70 (33%)
IG_like 267..348 CDD:214653 21/84 (25%)
Ig 270..339 CDD:299845 19/72 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.