DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and Kirrel3

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:XP_006510620.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus


Alignment Length:736 Identity:177/736 - (24%)
Similarity:275/736 - (37%) Gaps:183/736 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 DTFQATAELQLGDAPPVLLYSFI----EQTLQPGPAVSLKCSAAGNPTPQ----ISWTLDGFPLP 464
            |.|:...|.|        :|||.    :|.:..|..|:|.|:     .|:    :.|..||..| 
Mouse    37 DKFRRMNEGQ--------VYSFSQQPQDQVVVSGQPVTLLCA-----IPEYDGFVLWIKDGLAL- 87

  Fly   465 SNGRFMIG--QYITVHGDVIS---HVNISHVMVEDGGEYACIAENRAGRVQHAARLNIYGLPYIR 524
            ..||.:..  ||:.| |:.:|   |:.|....::|...|.|.|...|.| ...|||.:...|...
Mouse    88 GVGRDLSSYPQYLVV-GNHLSGEHHLKILRAELQDDAVYECQAIQAAIR-SRPARLTVLVPPDDP 150

  Fly   525 LI---PKVTAVSGETLNLKCPV-AGYPIEEIHWERGGRE----------LPDDIRQRVQPDGSLT 575
            :|   |.::..:|:.|||.|.. ...|...|.|.|.|..          |.|..|:.:.  .:|.
Mouse   151 IILGGPVISLRAGDPLNLTCHADNAKPAASIIWLRKGEVINGATYSKTLLRDGKRESIV--STLF 213

  Fly   576 ISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIV--PP--KLSPFQTNILQLNMGDRASLTCSV 636
            |||....:...: .|.|.||.....:.: .||:.:  ||  .||.....:|:.|:   .:..||.
Mouse   214 ISPGDVENGQSI-VCRATNKAIPGGKET-SVTIDIQHPPLVNLSVEPQPVLEDNI---VTFHCSA 273

  Fly   637 VKGDLPLTINWRKDGRPIDPTQHMSVKQV--DQYNSILVIENLGSDHTGNY-----SCVVRNSAA 694
            ..........|.|.|       |: :|:.  :.|.:.:       |:|  |     ||.|.|:..
Mouse   274 KANPAVTQYRWAKRG-------HI-IKEASGELYRTTV-------DYT--YFSEPVSCEVTNALG 321

  Fly   695 EVENSQALLVNVPPRWIVEPVDANVERNRHIMLHCQAQGVPTPSIVW-KKATGSKSGEYEEVRER 758
            ....|:.:.|...||...||....|:.....:..|...|.|:.:||| |:.:|            
Mouse   322 STNLSRTVDVYFGPRMTSEPQSLLVDLGSDAVFSCAWIGNPSLTIVWMKRGSG------------ 374

  Fly   759 PFTKLLGNGSLLLQHVKEDREGFYLCQA-NNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDT 822
              ..|....:|.|:.|:::..|.|:|:| ...:|.| .:.:.|.||..|..||| ::.....|:.
Mouse   375 --VVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAG-EREVTLTVNGPPIISST-QTQHALHGEK 435

  Fly   823 ALLQCAV-SGDKPINIVWMRSGKNTLNPSTNYKISVKQEATPDGVSAELQIRTVDATD-SGPYFC 885
            ..::|.: |...|..|.|... :|.|...|:.:.:|:...|.:||.:.|.|..:...| ...|.|
Mouse   436 GQIKCFIRSTPPPDRIAWSWK-ENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNC 499

  Fly   886 RASNLYGNDQQLVQLQVQEPPLPPS-------------------------VLEAAMI------SS 919
            .|.|.:|:|.::::|:.|...:...                         ||.|.::      |.
Mouse   500 TAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIGVAVGAGVAFLVLMATIVAFCCARSQ 564

  Fly   920 RSVNIKWQPKTLGTG-----------------------DVTKYIV-----EFREA-DHSLPPALF 955
            ||..  .:|...|.|                       |:...||     ..||| ||:....|.
Mouse   565 RSTG--GRPGISGRGTEKKARLRLPRRANLKGVVSAKNDIRVEIVHKEPSSGREAEDHTTIKQLM 627

  Fly   956 VDQWQ--------QIEV--KDPPHFNAMIENLKPATR--YAFRVIAEGSAGRSAPSQELIVRTEP 1008
            :|:.:        |:||  ::...|    :|||..|.  |:.....|   ..|.|:..|......
Mouse   628 MDRGEFQQDSVLKQLEVLKEEEKEF----QNLKDPTNGYYSVNTFKE---HHSTPTISLSSCQPD 685

  Fly  1009 QRPAGP---PLSLSARPLSST 1026
            .||.|.   |..:|...:.||
Mouse   686 LRPTGKQRVPTGMSFTNIYST 706

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352 3/9 (33%)
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653 28/93 (30%)
IGc2 436..507 CDD:197706 22/79 (28%)
I-set 521..610 CDD:254352 26/102 (25%)
IGc2 533..597 CDD:197706 21/74 (28%)
Ig 630..699 CDD:143165 15/75 (20%)
IG_like 714..802 CDD:214653 21/89 (24%)
Ig 725..802 CDD:299845 19/78 (24%)
Ig 823..894 CDD:143165 20/72 (28%)
FN3 906..1006 CDD:238020 32/171 (19%)
FN3 1013..1111 CDD:238020 5/17 (29%)
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Kirrel3XP_006510620.1 IG_like 54..143 CDD:214653 28/96 (29%)
Ig strand A' 56..60 CDD:409353 1/3 (33%)
Ig strand B 64..71 CDD:409353 3/11 (27%)
Ig strand C 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 1/2 (50%)
Ig strand D 97..101 CDD:409353 2/3 (67%)
Ig strand E 104..116 CDD:409353 3/11 (27%)
Ig strand G 132..143 CDD:409353 5/11 (45%)
IgI_2_KIRREL3-like 149..246 CDD:409416 25/100 (25%)
Ig strand B 166..170 CDD:409416 3/3 (100%)
Ig strand C 180..184 CDD:409416 1/3 (33%)
Ig strand E 210..214 CDD:409416 1/3 (33%)
Ig strand F 224..229 CDD:409416 1/5 (20%)
Ig strand G 239..242 CDD:409416 0/3 (0%)
Ig <267..334 CDD:416386 17/83 (20%)
Ig strand B 267..274 CDD:409353 2/6 (33%)
Ig strand C 279..286 CDD:409353 1/6 (17%)
Ig strand C' 288..291 CDD:409353 2/10 (20%)
Ig strand D 298..302 CDD:409353 1/3 (33%)
Ig strand E 304..310 CDD:409353 3/7 (43%)
Ig strand G 321..334 CDD:409353 2/12 (17%)
Ig 335..416 CDD:416386 24/95 (25%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 1/9 (11%)
Ig strand C 365..371 CDD:409353 3/5 (60%)
Ig strand E 381..387 CDD:409353 2/5 (40%)
IgI_5_KIRREL3 418..515 CDD:409479 26/98 (27%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479 1/3 (33%)
Ig strand E 481..485 CDD:409479 1/3 (33%)
Ig strand F 496..501 CDD:409479 2/4 (50%)
Ig strand G 509..512 CDD:409479 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.