DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and chl1a

DIOPT Version :10

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:XP_068072887.1 Gene:chl1a / 566148 ZFINID:ZDB-GENE-090313-201 Length:1310 Species:Danio rerio


Alignment Length:1349 Identity:331/1349 - (24%)
Similarity:528/1349 - (39%) Gaps:283/1349 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 IQVEISPNVLSVHMGGTAEFRCLVTSNGSPVGMQNILWYKDGRQLPSSGRVEDTLVVPRVSREN- 394
            |..:.|..::::.......|:|....|..|    ...|.|||...       |....|:|:.|. 
Zfish    34 ITAQTSGTIIALPYDERYIFKCEAKGNPRP----TFRWTKDGMDF-------DPHKDPQVTTEEN 87

  Fly   395 ---------------RGMYQCVVRRPEGDTFQATAELQLGDAPPVLLYSFIEQTLQP-----GPA 439
                           :|.|:|......|......||..:...|     .|.::.::|     |.:
Zfish    88 TGTFEIPNKKDKVKYQGKYRCYASNKLGTATSEEAEFIVPMVP-----KFPKEKIEPIVVTEGDS 147

  Fly   440 VSLKCS-AAGNPTPQISW-TLDGFPLPSNGRFMIGQYITVHGDVISHVNISHVMVEDG-GEYACI 501
            |.|:|: ..|.|..|:.| |.|...:..|.|..:|        :..::..|:.:|.|. .:|.|.
Zfish   148 VVLECNPPQGIPPWQLYWMTNDLRHIEQNERVSMG--------LSGNLYFSNTLVSDSHDDYCCF 204

  Fly   502 A-------------------------ENRAGRVQHAARLNIYGLPYIRLIPKVTAVS----GETL 537
            |                         |:...::....:.:|       |:|...:.:    ||.|
Zfish   205 ASFFKIRTIVQKPRMVLKVKPVDAKQEDGDAKIVQERKPSI-------LVPSSHSTTFLKKGEEL 262

  Fly   538 NLKCPVAGYPIEEIHWERGGRELPDDIRQRVQPDGSLTISPVQKNSDSGVYTCWARNKQGHSARR 602
            .|:|...|.|..|:.|.:...:||.  |.:::..|.|...|..:..|.|.|.|.|:|:.|.....
Zfish   263 ELECIAEGLPTPEVEWIKIWGDLPK--RTQIKNFGKLLTIPNIREEDEGKYMCKAKNQHGEDVHH 325

  Fly   603 SGEVTVIVPP--KLSPFQTNILQLNMGDRASLTCSVVKGDLPLTINWRKDGRPID--PTQHMSVK 663
            . :|.|..||  :..|.::.:..:  |....:.||......| ||.|:::|:|:|  |:.|.  |
Zfish   326 F-QVEVEEPPSWQKEPLKSQLAWI--GSDIHINCSATGKPQP-TITWKRNGKPLDDFPSTHH--K 384

  Fly   664 QVDQYNSILVIENLGSDHTGNYSCVVRNS-AAEVENSQALLVNVPPRWIVEPVDANVERN----- 722
            .:|  :.|::::....| |..|.|...|. .:.:.|:..|::|.||..:.        ||     
Zfish   385 MLD--DRIIILKAEQKD-TAVYQCEASNKHGSLLANANVLVMNHPPLILT--------RNYLEYA 438

  Fly   723 ----RHIMLHCQAQGVPTPSIVWKK--ATGSKSGE-YEEVRERPFTKLLGNGSLLLQHVKEDREG 780
                :.:::.|.....|..::.|::  ..||..|| |         .||.||||.:..|:.:..|
Zfish   439 TMLGKSVIMDCNVFSSPPATLNWRREDPEGSVDGERY---------SLLKNGSLQIHKVEMEDMG 494

  Fly   781 FYLCQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGD----KPINIVWMR 841
            .|.|.|||..||. ....:|.:..|.......:.:.|.:|..|.|:|.|..|    :.:..||::
Zfish   495 QYKCLANNSEGTA-SITTELFIKDSTRIVEAPQDMKVIRGSVAELECQVECDPSLRRELEFVWLK 558

  Fly   842 SGKNTL-NPSTNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQEP 905
            .|.|.| |.|..|       .|.:|:   |||..|..:|.|.|.|........|.....:.|.:.
Zfish   559 DGINILSNSSERY-------FTDEGI---LQIFNVSHSDQGNYTCIVRTSLDQDTASAYITVLDV 613

  Fly   906 PLPPSVLEAAMISSRSVNIKWQPKTLGTGDVTKYIVEFREADHSLPPALFVDQWQQIEVKDPPHF 970
            |.||..|..:.:..|||.:.|...:.....:|::|:::.|: |..|     ::|:.:.......|
Zfish   614 PDPPVELLLSDLKDRSVKLHWVNTSDHNSPITEFIIQYEES-HWEP-----EKWKDLLRVSSRKF 672

  Fly   971 NAMIENLKPATRYAFRVIAEGSAGRSAPSQEL-IVRTEPQRPAGPPLSLSARPLSSTELLISWVA 1034
            :|.:. |.....|.|||||....|||.||... ..:|.|..|...|.::........::.||| .
Zfish   673 SAPLA-LYCHINYQFRVIAVNEIGRSHPSMPSGRYKTPPCAPDRNPENIKIEGHLPHQMDISW-E 735

  Fly  1035 PLPELRHGDIQGYNVGYKLSSSGNTAYNFTSVSGDGDGGNGEL------LLSGLAKFARYTVVVQ 1093
            ||..:.|   .|..:.||||      |....|.   |....::      ::.....|..|.|.:|
Zfish   736 PLLPVEH---NGPGLEYKLS------YRLLGVE---DSWKEQMVKRHSFVVRDTPTFVPYEVKIQ 788

  Fly  1094 AFNQVG--PGPLSEPTAAQTMED------------VPSRPPEDVRCAALSSQSLQVSWQPPPIYH 1144
            |||:.|  |||  :.....:.||            ||...|::|....|:|..|:|||.|.|...
Zfish   789 AFNRHGWAPGP--KVVTGYSGEDFDIWHCLEGDATVPLVAPDNVSAEVLNSTLLKVSWSPVPQTT 851

  Fly  1145 TNGLLQGYKLIFEPIIDDIQPSKDEVESRKTTAL------TMVLTGLRKYTNYSIQVLAHTRMGD 1203
            ..|.|.||.:.:.. ...:..||.....|::..:      ||| .||:.::.||:.|....|.|:
Zfish   852 LRGHLGGYTVNYWQ-TQSLLTSKKIPSERQSLTIPGNRSHTMV-PGLKPFSEYSLTVNVFNRRGN 914

  Fly  1204 GVVSKPLFCHSEEDVPEAPADIKVVSSSSQSLYISWLPPNEPNGVITKYSL-YTRVVNGRE--EL 1265
            |..|.|:...:.:.|||.|..:|..:....::.:.|.||:|.||.:|.|.| |..||:...  ||
Zfish   915 GPSSSPISFTTPQGVPEQPHYLKATNFQKDAITLVWAPPHETNGHLTGYLLQYQTVVDNETLGEL 979

  Fly  1266 NNEKRSLPSQQAYYEAKGLHPHMEYQFWVTASTRVGEGKSSRVSSQITTNRIPARIISFGGPVVR 1330
            |:...| .:....:..:.|.....|:|:::|.|:||.|  |.:|.:..|:  ||   :|..|...
Zfish   980 NSVNIS-GADTTQWVLRDLQEDNSYKFYLSACTQVGCG--SAISEKGGTD--PA---AFTKPEYS 1036

  Fly  1331 -PWRSTVTLPCTAVGKPKREWFKSDVALRQGGLHNSQLLDSGDLIISSLQLADGGNYSCQVDNGI 1394
             |..|||:           .|.:            |..|.:.::..|.|:..    :|....|  
Zfish  1037 FPEVSTVS-----------AWTE------------SYELSTSEVTTSELRQP----FSFTSSN-- 1072

  Fly  1395 GTDRLTHTLIVQVPPTAPVLYV----TSATSSSILMHWKCGFTGNAPITGYTLFYRRANGNTDEM 1455
             ||      |..|..|...|.|    |....:|..:.|:.    ....:...|:....|......
Zfish  1073 -TD------IPFVNATFSTLVVLNVSTFVRDTSARISWRT----RGEHSDSQLYVAIMNHRDGIW 1126

  Fly  1456 QLSRHASS----HELKGLMCGSTYQIHLSAQNKVG----------TSPTSTILHVRTQGQSPGHP 1506
            |||...::    |.::||..|:.|.:.|.|..:||          |...|:...:.:|....|..
Zfish  1127 QLSEALNTSKGFHLVEGLSPGTVYTVRLQASRRVGVPSIFEEVFKTRKASSRQEMGSQEWFVGMM 1191

  Fly  1507 ASTALLAPNSTSLLVRLHSWPDNGCPLL------YFVLQYRAVTDDPDA 1549
            .:.|||     :|||.:      ||.:|      |.|.:...:..||::
Zfish  1192 CAVALL-----TLLVLI------GCFVLKNKGGKYAVKEKENIPADPES 1229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 30..128 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand E 86..90 CDD:409353
Ig strand F 106..111 CDD:409353
Ig strand G 119..123 CDD:409353
V-set 138..229 CDD:462230
Ig 238..327 CDD:472250
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 293..297 CDD:409353
Ig strand F 307..312 CDD:409353
Ig strand G 320..323 CDD:409353
Ig 330..418 CDD:472250 20/102 (20%)
Ig strand B 348..352 CDD:409353 1/3 (33%)
Ig strand C 365..369 CDD:409353 0/3 (0%)
Ig strand E 383..387 CDD:409353 1/3 (33%)
Ig strand F 397..402 CDD:409353 2/4 (50%)
Ig strand G 411..414 CDD:409353 0/2 (0%)
IgI_4_Dscam 422..517 CDD:409548 23/127 (18%)
Ig strand A 422..425 CDD:409548 1/2 (50%)
Ig strand A' 431..435 CDD:409548 0/3 (0%)
Ig strand B 438..447 CDD:409548 3/9 (33%)
Ig strand C 452..458 CDD:409548 2/6 (33%)
Ig strand C' 460..463 CDD:409548 0/2 (0%)
Ig strand D 468..476 CDD:409548 2/7 (29%)
Ig strand E 480..489 CDD:409548 0/8 (0%)
Ig strand F 496..504 CDD:409548 3/32 (9%)
Ig strand G 507..517 CDD:409548 0/9 (0%)
IgI_5_Dscam 521..608 CDD:409550 25/90 (28%)
Ig strand A 521..523 CDD:409550 0/1 (0%)
Ig strand A' 528..532 CDD:409550 0/3 (0%)
Ig strand B 535..542 CDD:409550 3/6 (50%)
Ig strand C 549..555 CDD:409550 2/5 (40%)
Ig strand C' 556..558 CDD:409550 0/1 (0%)
Ig strand D 565..569 CDD:409550 1/3 (33%)
Ig strand E 572..578 CDD:409550 2/5 (40%)
Ig strand F 586..594 CDD:409550 4/7 (57%)
Ig strand G 598..608 CDD:409550 1/9 (11%)
Ig 611..704 CDD:472250 25/97 (26%)
Ig strand B 630..634 CDD:409353 0/3 (0%)
Ig strand C 644..648 CDD:409353 2/3 (67%)
Ig strand E 670..674 CDD:409353 1/3 (33%)
Ig strand F 684..689 CDD:409353 2/4 (50%)
Ig strand G 697..700 CDD:409353 1/2 (50%)
IgI_7_Dscam 707..802 CDD:409546 28/106 (26%)
Ig strand A 707..711 CDD:409546 2/3 (67%)
Ig strand A' 716..720 CDD:409546 0/3 (0%)
Ig strand B 723..732 CDD:409546 1/8 (13%)
Ig strand C 738..744 CDD:409546 1/7 (14%)
Ig strand C' 750..753 CDD:409546 2/3 (67%)
Ig strand D 761..764 CDD:409546 0/2 (0%)
Ig strand E 767..773 CDD:409546 3/5 (60%)
Ig strand F 780..788 CDD:409546 4/7 (57%)
Ig strand G 793..802 CDD:409546 1/8 (13%)
Ig 806..892 CDD:472250 25/90 (28%)
Ig strand B 823..827 CDD:409353 2/3 (67%)
Ig strand C 836..840 CDD:409353 1/3 (33%)
Ig strand E 868..872 CDD:409353 1/3 (33%)
Ig strand F 882..887 CDD:409353 2/4 (50%)
FN3 <904..1195 CDD:442628 85/317 (27%)
FN3 906..1006 CDD:238020 28/100 (28%)
fn3 1221..1306 CDD:394996 26/87 (30%)
Ig 1336..1396 CDD:409353 8/59 (14%)
Ig strand B 1336..1340 CDD:409353 1/3 (33%)
Ig strand E 1371..1375 CDD:409353 0/3 (0%)
Ig strand F 1385..1390 CDD:409353 1/4 (25%)
FN3 <1407..>1606 CDD:442628 38/167 (23%)
fn3 1408..1491 CDD:394996 21/100 (21%)
chl1aXP_068072887.1 Ig 32..125 CDD:472250 20/101 (20%)
Ig strand B 51..55 CDD:409396 1/3 (33%)
Ig strand C 64..68 CDD:409396 0/3 (0%)
Ig strand E 89..93 CDD:409396 0/3 (0%)
Ig strand F 105..110 CDD:409396 2/4 (50%)
Ig strand G 119..122 CDD:409396 0/2 (0%)
Ig 134..224 CDD:472250 20/97 (21%)
Ig strand B 148..152 CDD:409432 2/3 (67%)
Ig strand C 162..166 CDD:409432 1/3 (33%)
Ig strand E 185..189 CDD:409432 0/3 (0%)
Ig strand F 200..205 CDD:409432 2/4 (50%)
Ig strand G 216..219 CDD:409432 0/2 (0%)
Ig 250..331 CDD:472250 23/83 (28%)
Ig strand B 262..266 CDD:409394 2/3 (67%)
Ig strand C 275..279 CDD:409394 1/3 (33%)
Ig strand E 296..300 CDD:409394 1/3 (33%)
Ig strand F 310..315 CDD:409394 2/4 (50%)
Ig strand G 323..326 CDD:409394 0/2 (0%)
Ig 336..422 CDD:472250 22/93 (24%)
Ig strand B 352..356 CDD:409367 0/3 (0%)
Ig strand C 365..369 CDD:409367 2/3 (67%)
Ig strand E 389..393 CDD:409367 1/3 (33%)
Ig strand F 402..407 CDD:409367 2/4 (50%)
Ig strand G 415..418 CDD:409367 0/2 (0%)
Ig 429..513 CDD:472250 25/101 (25%)
Ig strand B 445..449 CDD:409544 0/3 (0%)
Ig strand C 458..462 CDD:409544 0/3 (0%)
Ig strand E 481..485 CDD:409544 3/3 (100%)
Ig strand F 495..500 CDD:409544 2/4 (50%)
Ig strand G 508..511 CDD:409544 0/2 (0%)
Ig 517..617 CDD:472250 29/109 (27%)
Ig strand B 536..540 CDD:409359 2/3 (67%)
Ig strand C 553..557 CDD:409359 1/3 (33%)
Ig strand E 576..580 CDD:409359 2/6 (33%)
Ig strand F 590..595 CDD:409359 2/4 (50%)
Ig strand G 603..606 CDD:409359 0/2 (0%)
FN3 614..703 CDD:238020 28/95 (29%)
fn3 717..797 CDD:394996 23/92 (25%)
FN3 <783..1099 CDD:442628 99/363 (27%)
FN3 1092..1172 CDD:238020 17/83 (20%)
Bravo_FIGEY 1209..1290 CDD:464016 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.