DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and ROBO4

DIOPT Version :10

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_061928.4 Gene:ROBO4 / 54538 HGNCID:17985 Length:1007 Species:Homo sapiens


Alignment Length:1049 Identity:212/1049 - (20%)
Similarity:323/1049 - (30%) Gaps:394/1049 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 DAPPVLLYSFIEQTLQ-PGPAVSLKCSAAGNPTPQISWTLDGFPLPSNGRFMIGQYITVHGDVIS 483
            |:||.:|....:|..| |||| .:.|.|:|.|.|.|.|.|:|.||.                   
Human    29 DSPPQILVHPQDQLFQGPGPA-RMSCQASGQPPPTIRWLLNGQPLS------------------- 73

  Fly   484 HVNISHVMVEDGGEYACIAENRAGRVQHAARLNIYGLPYIRLIPKVTAVSGETLNLKCPVAGYPI 548
                   ||.....:                          |:|     .|..|.|:.|..|:  
Human    74 -------MVPPDPHH--------------------------LLP-----DGTLLLLQPPARGH-- 98

  Fly   549 EEIHWERGGRELPDDIRQRVQPDGSLTISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIVPPK 613
                 ...|:.|                     ::|.|||||.|.|:.|.:..|...::|.|..:
Human    99 -----AHDGQAL---------------------STDLGVYTCEASNRLGTAVSRGARLSVAVLRE 137

  Fly   614 LSPFQTNILQLNMGDRASLTCSVVKGDLPLTINWRKDGRP--IDPTQHMSVKQVDQYNSILVIEN 676
            ....|...:...:|::.:|.|....|....|::|.|||:|  :.|.:|     .....|:|:...
Human   138 DFQIQPRDMVAVVGEQFTLECGPPWGHPEPTVSWWKDGKPLALQPGRH-----TVSGGSLLMARA 197

  Fly   677 LGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWIVEPVDANVERNRHIMLHCQAQGVPTPSIVW 741
            ..||. |.|.||..|||...|:..|.:....|:...|||:         :|..:.|         
Human   198 EKSDE-GTYMCVATNSAGHRESRAARVSIQEPQDYTEPVE---------LLAVRIQ--------- 243

  Fly   742 KKATGSKSGEYEEVRERPFTKLLGNGSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSP 806
                                  |.|.:||                                |..|
Human   244 ----------------------LENVTLL--------------------------------NPDP 254

  Fly   807 YFSSTSRSVMVKKGDTALLQCAVSGDKPINIVWMR---SGKNTLNPSTNYKISVKQEATPDGVSA 868
                                  ..|.||...||:.   ||...  |:.:|....:.:..|.|   
Human   255 ----------------------AEGPKPRPAVWLSWKVSGPAA--PAQSYTALFRTQTAPGG--- 292

  Fly   869 ELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGT 933
                                              |..|....:|..           ||...|| 
Human   293 ----------------------------------QGAPWAEELLAG-----------WQSAELG- 311

  Fly   934 GDVTKYIVEFREADHSLPPALFVDQWQQIEVKDPPHFNAMIENLKPATRYAFRVIAEGSAGRSAP 998
                               .|   .|.|                    .|.|:|.......|...
Human   312 -------------------GL---HWGQ--------------------DYEFKVRPSSGRARGPD 334

  Fly   999 SQELIVRTEPQRPAGPPLSLSARPLSSTELLISWVAPLPELRHGDIQGYNVGYKLSSSGNTAY-- 1061
            |..|::|...:.|:.||..::.:|.:.| :.:|||.|..|..:|.|:||.|.    |.|||:.  
Human   335 SNVLLLRLPEKVPSAPPQEVTLKPGNGT-VFVSWVPPPAENHNGIIRGYQVW----SLGNTSLPP 394

  Fly  1062 -NFTSVSGDGDGGNGELLLSGLAKF--ARYTVVVQAFNQVGPGPLSEPTA---AQTMEDVPSRPP 1120
             |:|.|        ||.....:|..  ..|.|.|.|....|.|..|.|..   .|.||.....|.
Human   395 ANWTVV--------GEQTQLEIATHMPGSYCVQVAAVTGAGAGEPSRPVCLLLEQAMERATQEPS 451

  Fly  1121 EDVRCAALSSQSLQVSWQPPPIYHTNGLLQGYKLIFEPIIDDIQPSKDEVESRKTTALTMVLTGL 1185
            |.   ...:.:.|:.:.:.|.:..|.|:                            ||.::|.| 
Human   452 EH---GPWTLEQLRATLKRPEVIATCGV----------------------------ALWLLLLG- 484

  Fly  1186 RKYTNYSIQVLAHTR------MGDGVVSKPLFCHSEEDVPEAPADIKVVSSSSQSLYISWLPPNE 1244
                   ..|..|.|      :|.|     |:.::.||   |....::..|.||.|..:|...:.
Human   485 -------TAVCIHRRRRARVHLGPG-----LYRYTSED---AILKHRMDHSDSQWLADTWRSTSG 534

  Fly  1245 PNGVITKYSLYTRV-VNGREELNNEKRSLPSQQAYYEAKGLHPHMEYQFWVTASTRVGEGKSSRV 1308
            ...:.:..||.:|: .:.|:.|:. :|||.|..:......|.|... .|:.:....:.....:|.
Human   535 SRDLSSSSSLSSRLGADARDPLDC-RRSLLSWDSRSPGVPLLPDTS-TFYGSLIAELPSSTPARP 597

  Fly  1309 SSQI-TTNRIPARIISFGGPVVRPWRSTVTLPCTAVG--------KPKREW-FKSDVALRQGGLH 1363
            |.|: ...|:|.::.....|.     |:....|:..|        .|...| .|....|:..  :
Human   598 SPQVPAVRRLPPQLAQLSSPC-----SSSDSLCSRRGLSSPRLSLAPAEAWKAKKKQELQHA--N 655

  Fly  1364 NSQLL-DSGDLIISSLQLADGGNYSCQVDNG-----------IGTDRL--THTLIVQVPPTAPVL 1414
            :|.|| .|..|.:.:.:|.:.|:.:.....|           :|...|  ::.|:.:..|.||:.
Human   656 SSPLLRGSHSLELRACELGNRGSKNLSQSPGAVPQALVAWRALGPKLLSSSNELVTRHLPPAPLF 720

  Fly  1415 -YVTSATSS 1422
             :.|..|.|
Human   721 PHETPPTQS 729

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 30..128 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand E 86..90 CDD:409353
Ig strand F 106..111 CDD:409353
Ig strand G 119..123 CDD:409353
V-set 138..229 CDD:462230
Ig 238..327 CDD:472250
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 293..297 CDD:409353
Ig strand F 307..312 CDD:409353
Ig strand G 320..323 CDD:409353
Ig 330..418 CDD:472250
Ig strand B 348..352 CDD:409353
Ig strand C 365..369 CDD:409353
Ig strand E 383..387 CDD:409353
Ig strand F 397..402 CDD:409353
Ig strand G 411..414 CDD:409353
IgI_4_Dscam 422..517 CDD:409548 22/95 (23%)
Ig strand A 422..425 CDD:409548 2/2 (100%)
Ig strand A' 431..435 CDD:409548 1/3 (33%)
Ig strand B 438..447 CDD:409548 3/8 (38%)
Ig strand C 452..458 CDD:409548 3/5 (60%)
Ig strand C' 460..463 CDD:409548 1/2 (50%)
Ig strand D 468..476 CDD:409548 0/7 (0%)
Ig strand E 480..489 CDD:409548 0/8 (0%)
Ig strand F 496..504 CDD:409548 0/7 (0%)
Ig strand G 507..517 CDD:409548 0/9 (0%)
IgI_5_Dscam 521..608 CDD:409550 19/86 (22%)
Ig strand A 521..523 CDD:409550 0/1 (0%)
Ig strand A' 528..532 CDD:409550 0/3 (0%)
Ig strand B 535..542 CDD:409550 2/6 (33%)
Ig strand C 549..555 CDD:409550 0/5 (0%)
Ig strand C' 556..558 CDD:409550 0/1 (0%)
Ig strand D 565..569 CDD:409550 0/3 (0%)
Ig strand E 572..578 CDD:409550 0/5 (0%)
Ig strand F 586..594 CDD:409550 6/7 (86%)
Ig strand G 598..608 CDD:409550 1/9 (11%)
Ig 611..704 CDD:472250 26/94 (28%)
Ig strand B 630..634 CDD:409353 1/3 (33%)
Ig strand C 644..648 CDD:409353 1/3 (33%)
Ig strand E 670..674 CDD:409353 2/3 (67%)
Ig strand F 684..689 CDD:409353 2/4 (50%)
Ig strand G 697..700 CDD:409353 1/2 (50%)
IgI_7_Dscam 707..802 CDD:409546 10/94 (11%)
Ig strand A 707..711 CDD:409546 1/3 (33%)
Ig strand A' 716..720 CDD:409546 0/3 (0%)
Ig strand B 723..732 CDD:409546 1/8 (13%)
Ig strand C 738..744 CDD:409546 0/5 (0%)
Ig strand C' 750..753 CDD:409546 0/2 (0%)
Ig strand D 761..764 CDD:409546 0/2 (0%)
Ig strand E 767..773 CDD:409546 2/5 (40%)
Ig strand F 780..788 CDD:409546 0/7 (0%)
Ig strand G 793..802 CDD:409546 0/8 (0%)
Ig 806..892 CDD:472250 12/88 (14%)
Ig strand B 823..827 CDD:409353 0/3 (0%)
Ig strand C 836..840 CDD:409353 1/3 (33%)
Ig strand E 868..872 CDD:409353 0/3 (0%)
Ig strand F 882..887 CDD:409353 0/4 (0%)
FN3 <904..1195 CDD:442628 62/298 (21%)
FN3 906..1006 CDD:238020 15/99 (15%)
fn3 1221..1306 CDD:394996 18/85 (21%)
Ig 1336..1396 CDD:409353 14/80 (18%)
Ig strand B 1336..1340 CDD:409353 0/3 (0%)
Ig strand E 1371..1375 CDD:409353 1/3 (33%)
Ig strand F 1385..1390 CDD:409353 0/4 (0%)
FN3 <1407..>1606 CDD:442628 6/17 (35%)
fn3 1408..1491 CDD:394996 6/16 (38%)
ROBO4NP_061928.4 Ig 32..133 CDD:472250 40/186 (22%)
Ig strand B 49..53 CDD:409353 1/4 (25%)
Ig strand C 62..66 CDD:409353 1/3 (33%)
Ig strand F 111..116 CDD:409353 4/4 (100%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
IgI_2_Robo 140..225 CDD:409389 26/90 (29%)
Ig strand A 140..143 CDD:409389 0/2 (0%)
Ig strand A' 145..149 CDD:409389 0/3 (0%)
Ig strand B 153..160 CDD:409389 2/6 (33%)
Ig strand C 168..173 CDD:409389 2/4 (50%)
Ig strand C' 175..178 CDD:409389 1/2 (50%)
Ig strand D 183..187 CDD:409389 1/8 (13%)
Ig strand E 190..196 CDD:409389 2/5 (40%)
Ig strand F 203..211 CDD:409389 4/7 (57%)
Ig strand G 214..225 CDD:409389 2/10 (20%)
fn3 350..432 CDD:394996 30/94 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 531..551 3/19 (16%)
PHA03247 <567..876 CDD:223021 33/171 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 713..793 6/17 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 806..826
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 971..1007
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.