Sequence 1: | NP_001261500.1 | Gene: | Dscam2 / 38788 | FlyBaseID: | FBgn0265296 | Length: | 2101 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001338930.1 | Gene: | NTM / 50863 | HGNCID: | 17941 | Length: | 367 | Species: | Homo sapiens |
Alignment Length: | 394 | Identity: | 95/394 - (24%) |
---|---|---|---|
Similarity: | 150/394 - (38%) | Gaps: | 84/394 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 575 TISPVQKNSDS-GVYTCWARNKQGHSAR--------RSGEVTVIVPPKLSPFQTNILQLNMGDRA 630
Fly 631 SLTCSVVKGDLPLT-INW---------RKDGRPIDPTQHMSVKQVDQYNSILVIENLGSDHTGNY 685
Fly 686 SCVVRNSAAEVENSQALLVNVPPRWIVEPVDANVERNRHIMLHCQAQGVPTPSIVWK----KATG 746
Fly 747 SKS-GEYEEVRERPFTKLLGNGSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSPYFSS 810
Fly 811 TSRSVMVKKGDTALLQCAVSGDKPINIVWMRSGKNTLNPSTNYKISVKQEATPDGVSAELQIRTV 875
Fly 876 DATDSGPYFCRASNLYGNDQQLVQL-QVQEPPL-----------------PPSVLEAAMISSRSV 922
Fly 923 NIKW 926 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dscam2 | NP_001261500.1 | Ig | 51..127 | CDD:299845 | |
Ig | 138..>203 | CDD:299845 | |||
I-set | 238..327 | CDD:254352 | |||
Ig | 247..327 | CDD:299845 | |||
I-set | 332..418 | CDD:254352 | |||
IGc2 | 344..407 | CDD:197706 | |||
IG_like | 432..517 | CDD:214653 | |||
IGc2 | 436..507 | CDD:197706 | |||
I-set | 521..610 | CDD:254352 | 13/43 (30%) | ||
IGc2 | 533..597 | CDD:197706 | 7/22 (32%) | ||
Ig | 630..699 | CDD:143165 | 17/78 (22%) | ||
IG_like | 714..802 | CDD:214653 | 22/92 (24%) | ||
Ig | 725..802 | CDD:299845 | 21/81 (26%) | ||
Ig | 823..894 | CDD:143165 | 21/70 (30%) | ||
FN3 | 906..1006 | CDD:238020 | 6/38 (16%) | ||
FN3 | 1013..1111 | CDD:238020 | |||
FN3 | 1119..1209 | CDD:238020 | |||
FN3 | 1219..1313 | CDD:238020 | |||
Ig | 1336..1402 | CDD:143165 | |||
FN3 | 1409..1498 | CDD:238020 | |||
FN3 | 1515..1588 | CDD:238020 | |||
NTM | NP_001338930.1 | Ig | 44..132 | CDD:416386 | 19/92 (21%) |
Ig strand A' | 44..49 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 51..59 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 59..63 | CDD:409353 | 1/6 (17%) | ||
FR2 | 64..70 | CDD:409353 | 2/5 (40%) | ||
Ig strand C | 64..70 | CDD:409353 | 2/5 (40%) | ||
CDR2 | 71..83 | CDD:409353 | 1/11 (9%) | ||
Ig strand C' | 72..76 | CDD:409353 | 0/3 (0%) | ||
Ig strand C' | 80..83 | CDD:409353 | 1/2 (50%) | ||
FR3 | 84..118 | CDD:409353 | 9/35 (26%) | ||
Ig strand D | 87..94 | CDD:409353 | 0/6 (0%) | ||
Ig strand E | 97..103 | CDD:409353 | 2/7 (29%) | ||
Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 119..123 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 123..132 | CDD:409353 | 1/8 (13%) | ||
FR4 | 125..132 | CDD:409353 | 1/6 (17%) | ||
Ig_3 | 136..205 | CDD:404760 | 22/84 (26%) | ||
Ig strand A' | 142..147 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 153..160 | CDD:409353 | 3/6 (50%) | ||
Ig strand C | 166..171 | CDD:409353 | 1/4 (25%) | ||
Ig strand D | 177..180 | CDD:409353 | 1/2 (50%) | ||
Ig strand E | 184..190 | CDD:409353 | 3/21 (14%) | ||
Ig strand F | 197..204 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 211..219 | CDD:409353 | 0/7 (0%) | ||
Ig_3 | 222..299 | CDD:404760 | 23/83 (28%) | ||
putative Ig strand A | 223..229 | CDD:409353 | 3/6 (50%) | ||
Ig strand B | 239..243 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 252..256 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 278..282 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 292..297 | CDD:409353 | 2/4 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |