DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and dpr12

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:229 Identity:57/229 - (24%)
Similarity:84/229 - (36%) Gaps:51/229 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 GNVGGEASAELRLTVA-TPI--QVEISPNVLSVHMGGTAEFRCLVTSNGSPVGM--QNILWYK-- 370
            |.:.|::..:..|..: :|:  ..|:..:..:|.:||||...|.| |....||:  ..|.|.:  
  Fly    57 GGINGDSKLDNNLDSSDSPMFEDSELMAHNTTVQLGGTAFLVCKV-SGVDRVGVNWNQISWIRRR 120

  Fly   371 ------DGRQL------------PSSGRVEDTLVVPRVSRENRGMYQCVVRRPEGDTFQATAELQ 417
                  .|.||            |.|...  ||.:..|.|.:.|||:|.|..|.| .......||
  Fly   121 DWHILSSGAQLYTNDERFAILHTPGSNMW--TLQIKFVQRRDHGMYECQVSTPTG-IISHFVNLQ 182

  Fly   418 LGDAPPVLLYSFIEQTLQPGPAVSLKCSAAGNPTP--QISWTLDGFPLPSNGRFMIGQYITVHGD 480
            : ..|...:....|..:..|..::|.|....:|||  .:.|       ..|.|.:  .|:....|
  Fly   183 V-VVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYVYW-------QKNDRLI--NYVDSRRD 237

  Fly   481 VI----------SHVNISHVMVEDGGEYACIAEN 504
            :.          |.:.|....|.|.|.|.|.|.|
  Fly   238 ITIETTPGPRTQSRLIIREPQVTDSGNYTCSASN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352 3/13 (23%)
Ig 247..327 CDD:299845 3/13 (23%)
I-set 332..418 CDD:254352 30/107 (28%)
IGc2 344..407 CDD:197706 26/84 (31%)
IG_like 432..517 CDD:214653 20/85 (24%)
IGc2 436..507 CDD:197706 20/81 (25%)
I-set 521..610 CDD:254352
IGc2 533..597 CDD:197706
Ig 630..699 CDD:143165
IG_like 714..802 CDD:214653
Ig 725..802 CDD:299845
Ig 823..894 CDD:143165
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
dpr12NP_652462.3 IG 86..183 CDD:214652 29/100 (29%)
Ig_3 193..271 CDD:404760 20/86 (23%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 1/10 (10%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.