DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and DIP-gamma

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:368 Identity:89/368 - (24%)
Similarity:141/368 - (38%) Gaps:63/368 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   612 PKLSPFQTNILQLNMGDRASLTCSVVKGDLPLTINWRK---------DGRPIDPTQHMSVKQVDQ 667
            |:...|..|: ....|..|.|.|| |:......:.|.:         .||.:.....:||...|.
  Fly    39 PEFIGFINNV-TYPAGREAILACS-VRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDM 101

  Fly   668 YNSILVIENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWIVE--PVDANVERNRHIMLHCQ 730
            :...|.|..|.....|.|.|.: |::...:....:.|.|||..|.|  ..|..|:......|.|:
  Fly   102 HTWKLKISKLRESDRGCYMCQI-NTSPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCK 165

  Fly   731 AQGVPTPSIVWKKATGS-----KSGEYEEVRERPFTKLLGNG-SLLLQHVKEDREGFYLCQANNG 789
            |.|.|.|.:.|::..|.     |.|..|.::...:     || ||.|..::..:.|.|||.|:|.
  Fly   166 ATGNPQPRVTWRREDGEMILIRKPGSRELMKVESY-----NGSSLRLLRLERRQMGAYLCIASND 225

  Fly   790 IGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAV-SGDKPINIVWMRSGKNTLNPSTNY 853
            :...:.|.:.|.|..:|...:.|:.:....|....|:|.| :...|:: .|:: |..|.|...:.
  Fly   226 VPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVS-YWLK-GARTSNGFASV 288

  Fly   854 KISVKQEATP-----------------DGVSAE--LQIRTVDATDSGPYFCRASNLYGNDQQLVQ 899
            ..:..:..:|                 ||....  |.:|:...:|.|.|.|.::|..|..:.  .
  Fly   289 STASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEG--T 351

  Fly   900 LQVQEPPLPP--------------SVLEAAMISSRSVNIKWQP 928
            |::.|..|.|              .:.|||..:.||....|||
  Fly   352 LRLYEIKLHPGASASNDDHLNYIGGLEEAARNAGRSNRTTWQP 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653
IGc2 436..507 CDD:197706
I-set 521..610 CDD:254352
IGc2 533..597 CDD:197706
Ig 630..699 CDD:143165 18/77 (23%)
IG_like 714..802 CDD:214653 26/93 (28%)
Ig 725..802 CDD:299845 24/82 (29%)
Ig 823..894 CDD:143165 19/90 (21%)
FN3 906..1006 CDD:238020 10/37 (27%)
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 21/94 (22%)
Ig 47..129 CDD:299845 20/84 (24%)
Ig 140..238 CDD:299845 30/102 (29%)
IG_like 247..355 CDD:214653 22/111 (20%)
Ig 256..351 CDD:299845 20/98 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.