DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and dpr13

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:500 Identity:108/500 - (21%)
Similarity:160/500 - (32%) Gaps:171/500 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 LPVLSG------PRV--RLLGP-----ILAIEAVTGEDSGVYKCTAGNVGGEASAELRLTVAT-P 330
            :|..||      .||  ||..|     |:|..|..|........:.|  ||:..|....|.|: |
  Fly     1 MPASSGLYRIKNGRVLDRLQKPAALIFIIAYIAACGICDHTASASPG--GGKTVAATMTTPASEP 63

  Fly   331 IQVEISPNVL-------------------SVHMGGTAEFRCLVTSNGSPVGMQNILWYKDGRQLP 376
            ....|:.|::                   :...||::     :||..|    .|::   ||:..|
  Fly    64 SVRHINQNLIMSQSKEGEPVPVPQPYAQSAASAGGSS-----ITSFDS----TNVI---DGQSQP 116

  Fly   377 SSGRVEDTLVV----PRV-SRENRGMYQCVVRRPE--------GDTFQATAELQLGDAPPVLLYS 428
            :...:::.::.    .|: :::..|.|...|.|||        .:..:...|...|..    :|.
  Fly   117 TPTHLQEAVLQTHSHSRIQAKDTAGPYPIPVHRPEPVENHLEANNGIEGGMESLFGTP----MYF 177

  Fly   429 FIEQ----TLQPGPAVSLKCSAAGNPTPQISW---------TLDGFPLPSNGRFMIGQYITVHGD 480
            ..|.    |.|.|....:.|:........:||         |:......|:.||.     ..|  
  Fly   178 GTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFS-----ATH-- 235

  Fly   481 VISH-----VNISHVMVEDGGEYAC---------------IAENRAGRVQHAARLNIYGLPYIRL 525
             :.|     :.|..|.:.|.|.|.|               :.|         ||..|.|.|...|
  Fly   236 -LKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVE---------ARAEITGPPIRYL 290

  Fly   526 IPKVTAVSGETLNLKCPVA--GYPIEEIHWERGGRELPDDIRQRV----QPD---GSLTISPVQK 581
            .|      |.||.|:|.|.  ....|.|.|....|.:..||.:.:    :||   ..|||...::
  Fly   291 TP------GSTLRLQCRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRR 349

  Fly   582 NSDSGVYTCWARNKQGHSARRSGEVTVIVPPKLSPFQTNILQLNMGDRASLTCSVVKGDLPLTIN 646
             ..||.:||.|.|.|                                .||:...:.|||.|..:.
  Fly   350 -EHSGNFTCVASNTQ--------------------------------PASVLVHIFKGDNPAAMY 381

  Fly   647 WRKDGRPIDPTQHMSVKQVDQYNSILVIENLGSD--HTGNYSCVV 689
            ....|.....||       .|.:.|::|...|..  ||..|..:|
  Fly   382 HGHVGGSTKTTQ-------SQLHMIMIIIASGYRIFHTSVYMKIV 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352 16/59 (27%)
Ig 247..327 CDD:299845 16/59 (27%)
I-set 332..418 CDD:254352 19/117 (16%)
IGc2 344..407 CDD:197706 16/75 (21%)
IG_like 432..517 CDD:214653 21/117 (18%)
IGc2 436..507 CDD:197706 17/99 (17%)
I-set 521..610 CDD:254352 27/97 (28%)
IGc2 533..597 CDD:197706 23/72 (32%)
Ig 630..699 CDD:143165 16/61 (26%)
IG_like 714..802 CDD:214653
Ig 725..802 CDD:299845
Ig 823..894 CDD:143165
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
dpr13NP_001033956.2 V-set 180..276 CDD:284989 19/103 (18%)
IG_like 182..262 CDD:214653 18/87 (21%)
IG_like 285..362 CDD:214653 25/83 (30%)
IGc2 292..361 CDD:197706 23/75 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.