DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and ImpL2

DIOPT Version :10

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:226 Identity:57/226 - (25%)
Similarity:77/226 - (34%) Gaps:53/226 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 RPEGDTFQATAELQLGDAPPVLLYSFIEQTLQPGPAVSLKCSAAGNPTPQISWTLDGFP------ 462
            :|....|:|. .|:....||..|..      ..|..:.:.|...|:..|.|.|.:...|      
  Fly    47 KPRNRAFEAD-WLKFTKTPPTKLQQ------ADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDD 104

  Fly   463 LPSNGRFMIGQYITVHGDVISHVNISHV---MVEDGGEYACIAEN-----RAGRVQHAARLNIYG 519
            |.||      |........|..|..||:   ::.:...|.|:...     .|..|.|..|.:   
  Fly   105 LDSN------QVAEEAPSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSS--- 160

  Fly   520 LPYIRLIPKVT-----------------AVSGETLNLKCPVAGYPIEEIHW-ERGGRELPDDIRQ 566
                ||.|:.|                 .:.|..:.|.|.|...|..||.| ....:|:....|.
  Fly   161 ----RLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRH 221

  Fly   567 RVQPDGSLTISPVQKNSDSGVYTCWARNKQG 597
            ||..:|.|.||.: |..|.|.|.|.|||..|
  Fly   222 RVLANGDLLISEI-KWEDMGNYKCIARNVVG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 30..128 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand E 86..90 CDD:409353
Ig strand F 106..111 CDD:409353
Ig strand G 119..123 CDD:409353
V-set 138..229 CDD:462230
Ig 238..327 CDD:472250
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 293..297 CDD:409353
Ig strand F 307..312 CDD:409353
Ig strand G 320..323 CDD:409353
Ig 330..418 CDD:472250 4/13 (31%)
Ig strand B 348..352 CDD:409353
Ig strand C 365..369 CDD:409353
Ig strand E 383..387 CDD:409353
Ig strand F 397..402 CDD:409353
Ig strand G 411..414 CDD:409353 1/2 (50%)
IgI_4_Dscam 422..517 CDD:409548 24/108 (22%)
Ig strand A 422..425 CDD:409548 2/2 (100%)
Ig strand A' 431..435 CDD:409548 0/3 (0%)
Ig strand B 438..447 CDD:409548 1/8 (13%)
Ig strand C 452..458 CDD:409548 3/5 (60%)
Ig strand C' 460..463 CDD:409548 1/8 (13%)
Ig strand D 468..476 CDD:409548 1/7 (14%)
Ig strand E 480..489 CDD:409548 2/8 (25%)
Ig strand F 496..504 CDD:409548 2/7 (29%)
Ig strand G 507..517 CDD:409548 3/9 (33%)
IgI_5_Dscam 521..608 CDD:409550 29/95 (31%)
Ig strand A 521..523 CDD:409550 0/1 (0%)
Ig strand A' 528..532 CDD:409550 1/20 (5%)
Ig strand B 535..542 CDD:409550 1/6 (17%)
Ig strand C 549..555 CDD:409550 3/6 (50%)
Ig strand C' 556..558 CDD:409550 0/1 (0%)
Ig strand D 565..569 CDD:409550 2/3 (67%)
Ig strand E 572..578 CDD:409550 3/5 (60%)
Ig strand F 586..594 CDD:409550 4/7 (57%)
Ig strand G 598..608 CDD:409550 57/226 (25%)
Ig 611..704 CDD:472250
Ig strand B 630..634 CDD:409353
Ig strand C 644..648 CDD:409353
Ig strand E 670..674 CDD:409353
Ig strand F 684..689 CDD:409353
Ig strand G 697..700 CDD:409353
IgI_7_Dscam 707..802 CDD:409546
Ig strand A 707..711 CDD:409546
Ig strand A' 716..720 CDD:409546
Ig strand B 723..732 CDD:409546
Ig strand C 738..744 CDD:409546
Ig strand C' 750..753 CDD:409546
Ig strand D 761..764 CDD:409546
Ig strand E 767..773 CDD:409546
Ig strand F 780..788 CDD:409546
Ig strand G 793..802 CDD:409546
Ig 806..892 CDD:472250
Ig strand B 823..827 CDD:409353
Ig strand C 836..840 CDD:409353
Ig strand E 868..872 CDD:409353
Ig strand F 882..887 CDD:409353
FN3 <904..1195 CDD:442628
FN3 906..1006 CDD:238020
fn3 1221..1306 CDD:394996
Ig 1336..1396 CDD:409353
Ig strand B 1336..1340 CDD:409353
Ig strand E 1371..1375 CDD:409353
Ig strand F 1385..1390 CDD:409353
FN3 <1407..>1606 CDD:442628
fn3 1408..1491 CDD:394996
ImpL2NP_728961.2 PHA02785 <74..246 CDD:165149 45/185 (24%)
Ig_3 173..248 CDD:464046 22/75 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.