DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and CG13506

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:541 Identity:112/541 - (20%)
Similarity:193/541 - (35%) Gaps:97/541 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 LNLKCPVAGYPIEE----IHWERGGRELPDDIRQRVQPDGSLTISPVQKNSDSGVYTCWARNKQG 597
            |.:.|  ||.||:.    ..::....|..||     ..|....|..|.||               
  Fly    20 LYVSC--AGSPIDADVKGTDYQDDEYEYGDD-----TDDDDTQIIDVTKN--------------- 62

  Fly   598 HSARRSGEVTVIVPPKLSPFQTNILQLNMGDRASLTCSVVKGDLPLTINWRKDGRPIDPTQHMSV 662
            |:.:.:       ||........: :...||...|.|......|...:.|.|:...|...|:...
  Fly    63 HAEQEA-------PPYFDVTDLRV-EAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPIS 119

  Fly   663 KQVD-QYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWIVEPVDANVERNR--- 723
            ::|. ..|:.:::.|:..:.:.:|.|.:  ....|....||.|......:.:..|. .:|::   
  Fly   120 QRVQCMLNNSILLRNVSPEDSDDYYCEI--LPQRVRQHTALRVGARLSILCDDRDI-TDRSQTFR 181

  Fly   724 ---HIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLGNGSLLLQHVKEDREGFYLCQ 785
               |..|.|:.......:|.|         .:.::..:|.:....||.::|.:|.|...|.|.|.
  Fly   182 QGDHHKLECRTYLPDNATIKW---------SFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCL 237

  Fly   786 ANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGDKPI-NIVWMRSGKNTLNP 849
            |::|........:.:.|..||..|:...:|..:||.||.|.|.... ||| ...:::.|| ||..
  Fly   238 ADDGSRHPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRA-KPIGRSYFIKDGK-TLQL 300

  Fly   850 STNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLEA 914
            |..|  |:|.....|.....|.:|.|..:|.|.|.|:..|..|:::  |::.|...|..|. .|.
  Fly   301 SDKY--SLKDSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIGSNE--VKVHVSYNPETPQ-FED 360

  Fly   915 AMISSRSVNIKWQPKTLGTGDVTKYIVEFREADHSLPPALFVD-------QWQQIEVKDPPHFNA 972
            ..:....|.:.|..::                 |.|.....:|       .|..::|.: .|.:.
  Fly   361 MTVEGNKVTLHWLVRS-----------------HQLLSEAMLDYQLTGSYTWSTVQVLE-THRHN 407

  Fly   973 MIENLKPATR--------YAFRVIAEGSAGRSAPSQELIVRTEPQRPAGPPLSLSARPLSSTELL 1029
            ..:|:...|.        :..||..:.:.|.|..|.:.:..............:...|   .|::
  Fly   408 NTDNIWKITHQLELSRGVWHARVKTKNTKGWSHFSNDHVFEIPEDSEVDKDEEVELPP---DEIV 469

  Fly  1030 ISWVAPLPELRHGDIQGYNVG 1050
            .:.:.|:.:.....:|..|||
  Fly   470 QAGIMPMSKGAASSMQRLNVG 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653
IGc2 436..507 CDD:197706
I-set 521..610 CDD:254352 15/76 (20%)
IGc2 533..597 CDD:197706 14/63 (22%)
Ig 630..699 CDD:143165 13/69 (19%)
IG_like 714..802 CDD:214653 18/93 (19%)
Ig 725..802 CDD:299845 15/76 (20%)
Ig 823..894 CDD:143165 24/71 (34%)
FN3 906..1006 CDD:238020 18/114 (16%)
FN3 1013..1111 CDD:238020 7/38 (18%)
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 13/67 (19%)
IGc2 83..146 CDD:197706 13/62 (21%)
IG_like 176..254 CDD:214653 17/86 (20%)
Ig 176..239 CDD:299845 15/71 (21%)
I-set 258..349 CDD:254352 31/96 (32%)
Ig 275..348 CDD:143165 25/78 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.