DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and dpr19

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:441 Identity:86/441 - (19%)
Similarity:141/441 - (31%) Gaps:161/441 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 VHNTIYRCIASNS---VGRIVSRDVQVRAVVAQAY--KVDVEVLSAARGCTAILRCVVPTFVKEL 161
            :|.:.:..:.|::   ||:|.|........:...:  |.:..|: |.:|..|||.|||..   ..
  Fly     8 LHLSCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNTRVI-AQKGGLAILPCVVKV---NS 68

  Fly   162 VRVVSWVHEPAIYIYPSLQGDGKFHLLPTGELLIHNLQESDESQSFRCRSMHRLTRQVVVSSPTR 226
            ...|||:...            .|.||..|                  .|.|        ||..|
  Fly    69 PATVSWIRRK------------DFQLLTVG------------------LSTH--------SSDKR 95

  Fly   227 LRINSHRGIISPSVVEHTAHVQVSQDEGAVLLCVAQGCPSPEYSWFTHNGAGPLPVLSGPRVRLL 291
            .            :||||.|:.                     .|                    
  Fly    96 F------------LVEHTRHMG---------------------HW-------------------- 107

  Fly   292 GPILAIEAVTGEDSGVYKCTAGNVGGEASAELRLTVATPIQVEISPNVLSVHMGGTAEFR--C-L 353
              .|.|:||..||.|.|:|.. ::....|..:.|.:...: .||| :...:|:..|:..|  | |
  Fly   108 --SLRIKAVREEDRGFYECQL-SIYPTQSIVIELKIVEAV-AEIS-SAPELHIDETSTLRLECKL 167

  Fly   354 VTSNGSPVGMQNILWYKDGRQL--PSSGRVEDTLVVPRVSREN--RGMYQCVVRRPEGDTFQATA 414
            ..:..:|.   .:.||.|.:.:  .|.|    ..||..:.:.|  .|.:   .|....:..:||.
  Fly   168 KRATENPA---FVFWYHDSKMINYDSQG----GFVVTSIGQSNPQSGQF---YRSSPANKSRATM 222

  Fly   415 ELQLGDAPPVLLYSFIEQTLQPGPAVSLKCSAAGNPTPQISWTLDGFPLPSNGRFMIGQYITVH- 478
            .::..:.   :|.|.:      |.:.::|..||.              :||:..:|..|:.:.: 
  Fly   223 PMESSNG---VLNSLL------GSSDAIKAPAAN--------------VPSSTPYMTQQHQSAYL 264

  Fly   479 -GDVISHVNISHVMVEDGGEYACIAEN--------------RAGRVQHAAR 514
             ...:|.:.:..|.....|.|.|...|              :...:|||.|
  Fly   265 LNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHANR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845 6/27 (22%)
Ig 138..>203 CDD:299845 16/64 (25%)
I-set 238..327 CDD:254352 17/88 (19%)
Ig 247..327 CDD:299845 12/79 (15%)
I-set 332..418 CDD:254352 21/92 (23%)
IGc2 344..407 CDD:197706 15/69 (22%)
IG_like 432..517 CDD:214653 18/99 (18%)
IGc2 436..507 CDD:197706 14/86 (16%)
I-set 521..610 CDD:254352
IGc2 533..597 CDD:197706
Ig 630..699 CDD:143165
IG_like 714..802 CDD:214653
Ig 725..802 CDD:299845
Ig 823..894 CDD:143165
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 36/174 (21%)
IGc2 55..125 CDD:197706 33/165 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.