DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and DIP-zeta

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster


Alignment Length:510 Identity:114/510 - (22%)
Similarity:184/510 - (36%) Gaps:136/510 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 PEYSWFTHNGAGPLPVLSGPRVRLLGPILAI---EAVTGEDSGVYKCTAGNVGGEASAELRLTVA 328
            |.:.....||||     .|      ||:...   ..|.|.:..:   .||......::.|.:.|.
  Fly    61 PNFGGAAGNGAG-----GG------GPVAGSGTGSTVVGSNGVI---VAGGGANVPTSNLNIVVE 111

  Fly   329 TPIQVEISPNVLSVHMGGTAEFRCLVTSNGSPVGMQNILWYK---------DGRQLPSSGRVEDT 384
            .|...|...|| :|..|...:..|.|.:.||    ..:.|..         ....:..:.|:..|
  Fly   112 EPEFTEYIENV-TVPAGRNVKLGCSVKNLGS----YKVAWMHFEQSAILTVHNHVITRNPRISVT 171

  Fly   385 -----------LVVPRVSRENRGMYQCVVRRPEGDTFQATAELQLG----DAPPVL--LYSFIEQ 432
                       |.:..|..|:||.|.|.:.       ..||:.|.|    ..||.:  ..|..:.
  Fly   172 HDKHDRHRTWYLHINNVHEEDRGRYMCQIN-------TVTAKTQFGYLNVVVPPNIDDSLSSSDV 229

  Fly   433 TLQPGPAVSLKCSAAGNPTPQISWTLDGFPLPSNGRFMIGQYITVH---GDVISHVNISHVMVED 494
            .::.|..:||:|.|:|:|.|.|.|..|     .|.|..|.:...|:   ||.:....||.:   |
  Fly   230 IVREGANISLRCRASGSPRPIIKWKRD-----DNSRIAINKNHIVNEWEGDTLEITRISRL---D 286

  Fly   495 GGEYACIAENRA-GRVQHAARLNIYGLPYIRLIPK--VTAVSGETLNLKCPVAGYPIEEIHWERG 556
            .|.|.|||.|.. ..|....:::: ..|.:.|||.  |.|..|..:.::|....:|....:|.||
  Fly   287 MGAYLCIASNGVPPTVSKRIKVSV-DFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRG 350

  Fly   557 -GRELPDDIRQRVQ---------PDGSLTISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIV- 610
             |..:.|..:.:|:         ....|||..| .:.|.|:|.|.|:|.:|.:   .|.:.:.| 
  Fly   351 EGPIIHDSHKYKVEATVGLPAYKTHMKLTIINV-SSGDDGIYKCVAKNPRGET---DGIIRLYVS 411

  Fly   611 -PP--------------------------------------KLSPFQTNILQLNMGDRASLTCSV 636
             ||                                      |.:.:|:|:.::.:.::.|.   :
  Fly   412 YPPTTASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNLNEIGLSEQKSF---L 473

  Fly   637 VKGDLPLTINWRKD--------GRPIDPTQHMSVKQVDQYNSILVIEN-LGSDHT 682
            .|...||..|...:        .|..:|:..::...|.....:|.|.: :||.|:
  Fly   474 DKTQNPLLANGNANEADAESNGARGHNPSMAIAWLFVVIATLLLTIRSAVGSSHS 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352 13/62 (21%)
Ig 247..327 CDD:299845 13/62 (21%)
I-set 332..418 CDD:254352 21/105 (20%)
IGc2 344..407 CDD:197706 15/82 (18%)
IG_like 432..517 CDD:214653 27/88 (31%)
IGc2 436..507 CDD:197706 26/74 (35%)
I-set 521..610 CDD:254352 27/100 (27%)
IGc2 533..597 CDD:197706 19/73 (26%)
Ig 630..699 CDD:143165 13/62 (21%)
IG_like 714..802 CDD:214653
Ig 725..802 CDD:299845
Ig 823..894 CDD:143165
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/107 (21%)
Ig 130..200 CDD:143165 14/73 (19%)
I-set 226..310 CDD:254352 27/91 (30%)
IGc2 233..298 CDD:197706 26/72 (36%)
Ig 313..410 CDD:299845 27/100 (27%)
IG_like 325..410 CDD:214653 22/88 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.