DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and DIP-iota

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:313 Identity:75/313 - (23%)
Similarity:129/313 - (41%) Gaps:50/313 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   612 PKLS-PFQTNILQLNMGDRASLTCSVVKGDLPLTINW-RKDGRPIDPTQH--------MSVKQVD 666
            ||.| |...:.:.  :|..|.||| ||...:...:.| |.|.:.|...|:        :|:...:
  Fly    31 PKFSGPINNSTVP--VGRDALLTC-VVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHTE 92

  Fly   667 QYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWIVEPVDANVERN--RHIMLHC 729
            .....|.|.::.....|.|.|.:.....:.:... |.|.|||..:......:|.|:  :::.|.|
  Fly    93 HRIWQLKIRDVQESDRGWYMCQINTDPMKSQMGY-LDVVVPPDIVDYQTSQDVVRSTGQNVTLTC 156

  Fly   730 QAQGVPTPSIVWKKATG-----SKSGEYEEVRERPFTKLLGNGSLLLQHVKEDREGFYLCQANNG 789
            .|.|||.|:|.|::...     |..|:.|...       :...:|.|..|:....|.|||.|:||
  Fly   157 SATGVPMPTITWRREEATPILISDDGDREVFS-------VEGQNLTLWQVQRSHMGAYLCIASNG 214

  Fly   790 IGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGDKPINI-VWMRSGKNTLNPSTNY 853
            :...:.|.:.|.||.:|...:...::.|..|....|:| ::..:|.:: .|:|..:         
  Fly   215 VPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLEC-ITESQPASVNFWLRDSQ--------- 269

  Fly   854 KISVKQEATPDGVSAE--------LQIRTVDATDSGPYFCRASNLYGNDQQLV 898
               :.|..:.:.||.:        :.:|.:...|.|.|.|||.|..|...:::
  Fly   270 ---LLQGGSYESVSVDHVFRIVMRITLRPITKRDFGEYICRAKNAMGQTDRII 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653
IGc2 436..507 CDD:197706
I-set 521..610 CDD:254352
IGc2 533..597 CDD:197706
Ig 630..699 CDD:143165 17/77 (22%)
IG_like 714..802 CDD:214653 26/94 (28%)
Ig 725..802 CDD:299845 24/81 (30%)
Ig 823..894 CDD:143165 17/79 (22%)
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 18/88 (20%)
Ig 39..122 CDD:299845 18/85 (21%)
Ig 132..213 CDD:299845 24/87 (28%)
IG_like 141..227 CDD:214653 26/92 (28%)
IG_like 239..322 CDD:214653 19/94 (20%)
IGc2 245..313 CDD:197706 17/80 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.