DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and fipi

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:426 Identity:89/426 - (20%)
Similarity:166/426 - (38%) Gaps:58/426 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   591 WARNKQGHSARRSGEVTVIVPPKLSPFQTNILQLNMGDRASLTCSVVKGDLPLTINWRKDGRPI- 654
            ||.:.:..|              |||.:.::::..   ..||.......|..:.::|:.....| 
  Fly    18 WANHHESLS--------------LSPAEHSVVRYT---NESLIVQCRSPDPKVELHWKSPKGEII 65

  Fly   655 -DPTQHMSVKQVDQYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWIVEPVDAN 718
             :....:.::|.......:|..::.....||:||...:.:.. ..|..|:|.....:........
  Fly    66 REHKGRIHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLH-SKSFDLIVYQKITFTENATVMT 129

  Fly   719 VERNRHIMLHCQAQGVPTPSIVWK-KATGSKSGEYEEVRERPFTKLLGNGSLLLQHVKEDREGFY 782
            |:......:.|:.:|.|.|::.|. ......:|..::.:.|    :|.:| ||:..|.::..|.|
  Fly   130 VKEGEKATILCEVKGEPQPNVTWHFNGQPISAGAADDSKFR----ILADG-LLINKVTQNDTGEY 189

  Fly   783 LCQAN--NGIGTGI-GKVIQLKVNSSPYFSSTSRSVMVKK---GDTALLQCAVSGDKPINIVWMR 841
            .|:|.  |.|.:.: .:.:.:|:...|.:|.|. .|.:|.   ..||.|.|....:.|.|..|.|
  Fly   190 ACRAYQVNSIASDMQERTVLMKIEHKPIWSKTP-FVSLKYAYINGTATLMCEALAEPPANFTWYR 253

  Fly   842 SGKNTLNPSTNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQEPP 906
            . .|.|: |.|...:::.    |...:.|.|..::.:....|.|||.|..|..::..:|:..|.|
  Fly   254 K-HNKLH-SNNRLYTIQS----DSYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKP 312

  Fly   907 LPPSVLEAAMISSRSVNI-----KWQPKT-LG-TGDVTKYIVEFR-EADHSLPPALFVDQWQQIE 963
            ..|:..:....:|.:.::     :..|.: :| .|...:|:.|.. :.|        ..:|....
  Fly   313 PSPANFQLRGFNSNTFDVVLSAPRGPPDSPMGVNGFRIEYMTEMEFKTD--------AGKWTNAR 369

  Fly   964 VKD---PPHFNAMIENLKPATRYAFRVIAEGSAGRS 996
            .||   ......::.||:|.|.|..|..:...||.|
  Fly   370 RKDYAFEEGATFLLTNLEPDTVYLVRAASRNLAGFS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653
IGc2 436..507 CDD:197706
I-set 521..610 CDD:254352 3/18 (17%)
IGc2 533..597 CDD:197706 2/5 (40%)
Ig 630..699 CDD:143165 11/70 (16%)
IG_like 714..802 CDD:214653 19/91 (21%)
Ig 725..802 CDD:299845 18/80 (23%)
Ig 823..894 CDD:143165 20/70 (29%)
FN3 906..1006 CDD:238020 21/102 (21%)
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
fipiNP_787975.1 IG_like 33..115 CDD:214653 13/85 (15%)
I-set 128..202 CDD:254352 19/78 (24%)
Ig 133..>193 CDD:299845 15/64 (23%)
IG_like 228..307 CDD:214653 21/84 (25%)
Ig 235..305 CDD:143165 20/75 (27%)
FN3 312..415 CDD:238020 21/102 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.