DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and dpr2

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:378 Identity:79/378 - (20%)
Similarity:131/378 - (34%) Gaps:128/378 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 APPVLL--------YSFIEQTLQPG----PAV-SLKCSAAGNPT--PQISWTLDGFPLPSNGRFM 470
            |.|:|:        ::..:|.|.|.    ||| ||.....||..  |.:|       .||     
  Fly    12 ATPILVIMISISRAWTMQQQHLSPAIQQHPAVKSLSHLVDGNDNLLPMVS-------APS----- 64

  Fly   471 IGQYITVHGDVISHVNISHVMVEDGGEYACIAENRAGRVQHAARLNI------YGLPYIRLIPKV 529
                 ::..|.:...:::....:.|..   |.:.|....|.......      :|:|     ..:
  Fly    65 -----SIDNDYVYIASVNRKFPQFGNS---IDDEREAEEQPPEETTYPPPVFDFGMP-----RNI 116

  Fly   530 TAVSGETLNLKCPVAGYPIEEIHWERGGREL-----------PDD----IRQRVQPDGSLTISPV 579
            |..:|.|..:.|.|.....:.:.|.| .|:|           .|:    :|.....|.:|.:...
  Fly   117 TTRTGHTAAINCRVDNLGDKSVSWIR-KRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYA 180

  Fly   580 QKNSDSGVYTCWARNKQGHSARRSGEVTVIVPPKLS-PFQTNI----------------LQLNMG 627
            |.. |||:|.|                .|...||:| .|:.|:                |.:.:|
  Fly   181 QPR-DSGIYEC----------------QVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVG 228

  Fly   628 DRASLTCSVVKGDLPLT-------INWRKDGRPIDP-----------TQHMSVKQ--VDQYNSIL 672
            ...:|||.|.:   |.|       |.|.:....:.|           .|.:|::.  .::..|.|
  Fly   229 SSVTLTCHVKQ---PATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRL 290

  Fly   673 VIENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWIVEPVDANVERNRHI 725
            .|.|.....||||:|:...:.|     .:::|||    |.:...|.::::|.|
  Fly   291 RIANAQLLDTGNYTCMPTTAEA-----ASVVVNV----INDESPAAMQKSRAI 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653 19/91 (21%)
IGc2 436..507 CDD:197706 16/77 (21%)
I-set 521..610 CDD:254352 21/103 (20%)
IGc2 533..597 CDD:197706 18/78 (23%)
Ig 630..699 CDD:143165 21/88 (24%)
IG_like 714..802 CDD:214653 3/12 (25%)
Ig 725..802 CDD:299845 1/1 (100%)
Ig 823..894 CDD:143165
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 25/115 (22%)
Ig 116..192 CDD:299845 19/93 (20%)
ig 220..306 CDD:278476 21/88 (24%)
IG_like 220..306 CDD:214653 21/88 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.