DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and CG33543

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:429 Identity:100/429 - (23%)
Similarity:163/429 - (37%) Gaps:51/429 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 SARRSGEVTVIVPPKLSPFQTNILQLN-------MGDRASLTCSVVKGDLPLTINWRKD-GRPID 655
            |....|..|...||...|.....||.:       :.:...:.|..|:.|  :...||.. |:..:
  Fly    27 STSSGGSGTGGAPPDRPPTPPLSLQPSTPSITHFVNESFIIFCQTVQKD--IDTKWRDPRGQTRE 89

  Fly   656 PTQ---HMSVKQVDQYNSILVIENLGSDHTGNYSCVV-------RNSAAEVE--NSQALLVNVPP 708
            .|:   |:..|.....  .||.|::..:..||::|.|       ||...|.|  .|..||||...
  Fly    90 NTKGRVHIEKKTTGLL--ALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQKI 152

  Fly   709 RWIVEPVDANVERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLGNGSLLLQH 773
            .:.......:|...|..|::|..:|:|.|.:.|     ..:|||...........|.|| |.:::
  Fly   153 SFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSW-----LYNGEYINTVNSTKHNRLSNG-LYIRN 211

  Fly   774 VKEDREGFYLCQANNGIGTGIGK---VIQLKVNSSP--YFSSTSRSVMVKKGDTALLQCAVSGDK 833
            |.:...|.|.|:|.....|....   .|.|::...|  :|:.|........|....|.|...|:.
  Fly   212 VSQADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHWFFNETLPVQYAYVGGAVNLSCDAMGEP 276

  Fly   834 PINIVWMRSGKNTLNPSTNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQQLV 898
            |.:..|:.:.|..:  ..|::|.|..      ..|.||::..:|:..|.|.|:.:|..|..::::
  Fly   277 PPSFTWLHNNKGIV--GFNHRIFVAD------YGATLQLQMKNASQFGDYKCKVANPLGMLERVI 333

  Fly   899 QLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDVTKYIVEFREADHSLPPALF-VDQWQQI 962
            :|:....||.|...:...:.:....:..|...:........|..:|.|..|.....| ...|...
  Fly   334 KLRPGPKPLGPRRFQLKKLYTNGFELDIQTPRMSNVSDEMQIYGYRVAYMSDTEFKFSAGNWSYA 398

  Fly   963 EVKD-----PPHFNAMIENLKPATRYAFRVIAEGSAGRS 996
            :.:|     ..||  :|.:|:..|.|..|..:...||.|
  Fly   399 KQRDFSFHGGKHF--IIPHLETNTTYLMRAASRNLAGLS 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653
IGc2 436..507 CDD:197706
I-set 521..610 CDD:254352 3/10 (30%)
IGc2 533..597 CDD:197706
Ig 630..699 CDD:143165 20/81 (25%)
IG_like 714..802 CDD:214653 23/90 (26%)
Ig 725..802 CDD:299845 21/79 (27%)
Ig 823..894 CDD:143165 18/70 (26%)
FN3 906..1006 CDD:238020 21/97 (22%)
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 18/64 (28%)
IG_like 256..336 CDD:214653 19/87 (22%)
IGc2 263..327 CDD:197706 18/71 (25%)
FN3 341..445 CDD:238020 21/97 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.