Sequence 1: | NP_001261500.1 | Gene: | Dscam2 / 38788 | FlyBaseID: | FBgn0265296 | Length: | 2101 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006510497.1 | Gene: | Opcml / 330908 | MGIID: | 97397 | Length: | 354 | Species: | Mus musculus |
Alignment Length: | 351 | Identity: | 84/351 - (23%) |
---|---|---|---|
Similarity: | 132/351 - (37%) | Gaps: | 67/351 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 602 RSGEVTVIVPPKLSPFQTNILQLNMGDRASLTCSVVKGDLPLTINW---------RKDGRPIDPT 657
Fly 658 QHMSVKQVDQYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWIVEPVDANVERN 722
Fly 723 RHIMLHCQAQGVPTPSIVW-----KKATGSKS-GEYEEVRERPFTKLLGNGSLLLQHVKEDREGF 781
Fly 782 YLCQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGDKPINIVWMRSGKNT 846
Fly 847 LNPSTNYKISVKQEATPDGVSAE-------LQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQE 904
Fly 905 PPL----PPSVLEAAMISSRSVNIKW 926 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dscam2 | NP_001261500.1 | Ig | 51..127 | CDD:299845 | |
Ig | 138..>203 | CDD:299845 | |||
I-set | 238..327 | CDD:254352 | |||
Ig | 247..327 | CDD:299845 | |||
I-set | 332..418 | CDD:254352 | |||
IGc2 | 344..407 | CDD:197706 | |||
IG_like | 432..517 | CDD:214653 | |||
IGc2 | 436..507 | CDD:197706 | |||
I-set | 521..610 | CDD:254352 | 4/7 (57%) | ||
IGc2 | 533..597 | CDD:197706 | |||
Ig | 630..699 | CDD:143165 | 18/77 (23%) | ||
IG_like | 714..802 | CDD:214653 | 22/93 (24%) | ||
Ig | 725..802 | CDD:299845 | 20/82 (24%) | ||
Ig | 823..894 | CDD:143165 | 18/77 (23%) | ||
FN3 | 906..1006 | CDD:238020 | 5/25 (20%) | ||
FN3 | 1013..1111 | CDD:238020 | |||
FN3 | 1119..1209 | CDD:238020 | |||
FN3 | 1219..1313 | CDD:238020 | |||
Ig | 1336..1402 | CDD:143165 | |||
FN3 | 1409..1498 | CDD:238020 | |||
FN3 | 1515..1588 | CDD:238020 | |||
Opcml | XP_006510497.1 | Ig | 44..132 | CDD:416386 | 20/91 (22%) |
Ig strand A' | 44..49 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 51..59 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 59..63 | CDD:409353 | 1/5 (20%) | ||
FR2 | 64..70 | CDD:409353 | 1/5 (20%) | ||
Ig strand C | 64..70 | CDD:409353 | 1/5 (20%) | ||
CDR2 | 71..83 | CDD:409353 | 1/11 (9%) | ||
Ig strand C' | 72..76 | CDD:409353 | 0/3 (0%) | ||
Ig strand C' | 80..83 | CDD:409353 | 1/2 (50%) | ||
FR3 | 84..118 | CDD:409353 | 11/35 (31%) | ||
Ig strand D | 87..94 | CDD:409353 | 1/6 (17%) | ||
Ig strand E | 97..103 | CDD:409353 | 2/7 (29%) | ||
Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 119..123 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 123..132 | CDD:409353 | 1/8 (13%) | ||
FR4 | 125..132 | CDD:409353 | 1/6 (17%) | ||
Ig_3 | 135..206 | CDD:404760 | 23/86 (27%) | ||
Ig strand A | 135..138 | CDD:409353 | 2/2 (100%) | ||
Ig strand A' | 144..148 | CDD:409353 | 1/3 (33%) | ||
Ig strand B | 151..160 | CDD:409353 | 2/8 (25%) | ||
Ig strand C | 165..170 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 171..174 | CDD:409353 | 0/2 (0%) | ||
Ig strand F | 198..206 | CDD:409353 | 4/7 (57%) | ||
Ig_3 | 223..300 | CDD:404760 | 21/90 (23%) | ||
putative Ig strand A | 224..230 | CDD:409353 | 3/6 (50%) | ||
Ig strand B | 240..244 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 253..257 | CDD:409353 | 1/16 (6%) | ||
Ig strand E | 279..283 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 293..298 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 306..309 | CDD:409353 | 0/2 (0%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |