DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and Bsg

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster


Alignment Length:563 Identity:111/563 - (19%)
Similarity:167/563 - (29%) Gaps:222/563 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 QVEISPNVL----SVHMGGTAEFRCLV--------TSNGSPVGMQNILWYKDGRQ-----LPSSG 379
            :.|.||.:.    .|::|......|::        ..||.|:...|:   :.||.     |..|.
  Fly    34 EFEESPTIYYGDPVVNLGQPFSITCIIPITDQIHWLKNGEPITRHNL---RHGRDDHAYVLSESA 95

  Fly   380 ------RVEDTLVVPRVSRENRGMYQC---------VVRRPEG---------------------- 407
                  ::|..|.|....:.:.|.|||         .||.|:|                      
  Fly    96 IEGEKHKIEAHLSVRHALKVHEGRYQCNRRRGSYILHVRDPKGVGAGAGEPTESGYQTIDELTPN 160

  Fly   408 --DTFQATAELQ-------------------LG------------------------------DA 421
              |.|...|.|:                   ||                              |.
  Fly   161 SADDFFTRAWLEQQQQQQQLPHQSHKLHKSHLGYGNASLSGSQPWHPSAGGGGIHRVYSATPPDF 225

  Fly   422 PPVLLYSFIEQTL-QPGPAVSLKCSAAGNPTP-------------------------------QI 454
            ||..| :.:|||: .|.|...|.     ||.|                               |.
  Fly   226 PPPRL-NLLEQTVAPPEPPTILY-----NPNPTHPTASATATETSVLLTTAHHHAHHQQQLQQQS 284

  Fly   455 SWTLDGFPLPSNGRFMIGQY-------------ITVHG-----------------DVISHVNISH 489
            ..||:.|.||...|...||.             :.|.|                 ..||....:.
  Fly   285 QHTLNAFQLPLPPRPNPGQNERYQTYAPHYVPPVVVSGAGAGAGADPGAGASGEQTTISAATSTR 349

  Fly   490 VMVEDGGEYACIAENRA-----------------GRVQHAARLNIYGLPYIRLIPKVTAVSGE-- 535
            .|:..||..|....:..                 |...|.....:..:...:|:|.......:  
  Fly   350 AMMGGGGGVAGAGFSAGASGPMLGAGGHMLMGGQGHQVHLQHQTLLPVKMDKLVPNYDNAEHQMK 414

  Fly   536 ------TLNLKCPVA-GYPIEEIHWERGGRELPD--DIRQR---VQPDGSLTISPVQKNSDSGVY 588
                  .|.|.|.|. |.|...:.|::.|..:.|  .:|.|   :..:....|.....| |.|.|
  Fly   415 FYDIRSPLVLSCNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTN-DDGKY 478

  Fly   589 TCWARNKQGHSARRSGEVTVIVPPKLSPFQTNILQLNMGDRASLTCSVVKGDLPLTINWRKDGRP 653
            :|     :.....:..||...|..:: |..|.:::   |::.|:||||| |..| .:.|......
  Fly   479 SC-----EFDGVSKEIEVIARVVVRV-PSNTAVVE---GEKMSVTCSVV-GTKP-ELTWTFANVT 532

  Fly   654 I-DPTQHMSVKQVDQ--YNSILVIENLGSDHTGNYSCVVRNSA 693
            : :.|....:|..|.  .|:||.::|:..|..|.|.|:.||:|
  Fly   533 LTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352 29/160 (18%)
IGc2 344..407 CDD:197706 20/90 (22%)
IG_like 432..517 CDD:214653 27/163 (17%)
IGc2 436..507 CDD:197706 23/148 (16%)
I-set 521..610 CDD:254352 21/102 (21%)
IGc2 533..597 CDD:197706 17/77 (22%)
Ig 630..699 CDD:143165 23/67 (34%)
IG_like 714..802 CDD:214653
Ig 725..802 CDD:299845
Ig 823..894 CDD:143165
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
BsgNP_723346.2 IG_like 420..497 CDD:214653 20/82 (24%)
Ig 423..497 CDD:299845 19/79 (24%)
IG_like 500..583 CDD:214653 26/81 (32%)
Ig 512..575 CDD:143165 22/64 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10075
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.