DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and Igsf10

DIOPT Version :10

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:XP_038958192.1 Gene:Igsf10 / 310448 RGDID:735030 Length:2647 Species:Rattus norvegicus


Alignment Length:1050 Identity:251/1050 - (23%)
Similarity:406/1050 - (38%) Gaps:201/1050 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SSGGWLDCSASGSPQPTVDWVH-------ADGSAVTEIHGVRRVLRNGTLVLMPFAAAAYHQDVH 103
            :|..:|.|.|.|.|.|.:.|..       :.|:..:..|    ||.||||.:...:.....|   
  Rat  1687 NSDVFLPCEAVGDPLPIIHWTRVSSGLEISQGTQKSRFH----VLPNGTLSIQRVSIQDRGQ--- 1744

  Fly   104 NTIYRCIASNSVGRIVSRDVQVRAVVAQAYKVD--VEVLSAARGCTAILRCVV-----PTFVKEL 161
               |.|.|||.:| :....|.:..|...|..:|  |:.::...|.|..|:|.|     ||     
  Rat  1745 ---YLCSASNPLG-VDHLHVSLSVVSYPARILDRHVKEITVHSGSTVELKCRVEGMPRPT----- 1800

  Fly   162 VRVVSWVHEPAIYIYPSLQGDGKFHLLPTGELLIHNLQESDESQSFRCRSMH------RLTRQVV 220
               |||:......:..:.:|..|..:.|.|.|:|:||...|.. .::|.:.:      .|.:..|
  Rat  1801 ---VSWILANQTVVSETAKGSRKVWVTPDGTLIIYNLSLYDRG-FYKCVASNPSGQDSLLVKIQV 1861

  Fly   221 VSSPTRLRINSHRGIISPSVVEHTAHVQVSQDEGAVLL-CVAQGCPSPEYSWFTHNGAGPLPV-L 283
            :::|             |.::|......|....|::.| |.|:|.|.|...|..::|....|: |
  Rat  1862 ITAP-------------PVIIEQKRQAIVGVLGGSLKLPCTAKGTPQPSVHWVLYDGTELKPLQL 1913

  Fly   284 SGPRVRLL-GPILAIEAVTGEDSGVYKCTAGNVGGEASAELRLTVATPIQVEISPNV-------L 340
            :..|..|. ...|.|.::.....|.|:|.|.:..|   :|.|:.:.|..:.|..|.:       .
  Rat  1914 THSRFFLYPNGTLYIRSIAPSVRGTYECIATSSSG---SERRVVILTVEEGETIPRIETASQKWT 1975

  Fly   341 SVHMGGTAEFRCLVTSNGSPVGMQNILWYKDGRQLPSSGRVED--------------TLVVPRVS 391
            .|::|......|..|.:..|    .|:|     :|||...::.              :|||..|:
  Rat  1976 EVNLGEKLLLNCSATGDPKP----RIIW-----RLPSKAVIDQWHRMGSRIHVYPNGSLVVGSVT 2031

  Fly   392 RENRGMYQCVVRRPEGDTFQAT-AELQLGDAPPVLLYSFIEQTLQPGPAVSLKCSAAGNPTPQIS 455
            .::.|.|.||.|...||..... ..|:|..|.......|.:|.|. |....:.|.|:|:|.|::|
  Rat  2032 EKDAGDYLCVARNKMGDDLVLMHVRLRLTPAKIEQKQYFKKQVLH-GKDFQVDCKASGSPVPEVS 2095

  Fly   456 WTL-DGFPL-----PSNGRFMIGQYITVHGDVISHVNISHVMVEDGGEYACIAENRAGRVQHAAR 514
            |:| ||..|     ..:..:...:|...|...:...|:.  |.|: |:|.|.|:|..|:.:....
  Rat  2096 WSLPDGTVLNNVAQADDSGYRTKRYTLFHNGTLYFNNVG--MAEE-GDYICSAQNTLGKDEMKVH 2157

  Fly   515 LNIY-GLPYIRLIPKVT--AVSGETLNLKCPVAGYPIEEIHWERGGRELP-------DDIRQRVQ 569
            |.:. .:|.||...|.|  ..:|:|..|.|.|.|.|...:.|     .||       .:.|....
  Rat  2158 LTVLTAIPRIRQSYKTTMRLRAGDTAVLDCEVTGEPKPNVFW-----LLPSNNVISFSNDRFTFH 2217

  Fly   570 PDGSLTISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIVPPKLSPFQTNILQLNMGDRASLTC 634
            .:.:|:|..| |..|||.|.|.|:|..|...:......|..||.::....|        :..:..
  Rat  2218 ANRTLSIHKV-KPLDSGDYVCVAQNPSGDDTKTYKLDIVSKPPLINGLYAN--------KTVIKA 2273

  Fly   635 SVVK----------GDLPLT-INWRKDGRPIDPTQHMSVKQVDQYNSILVIENLGSDHTGNYSCV 688
            :.::          ..:|.: :.|...|....|..:...:.....|..|.:.|:....:.:::||
  Rat  2274 TAIRHSKKYFDCRADGIPSSQVTWIMPGNIFLPAPYFGSRVTVHPNGTLEMRNIRLSDSADFTCV 2338

  Fly   689 VRNSAAEVENSQALLVNVPPRWIVEPVDANVERN-----------RHIMLHCQAQGVPTPSIVWK 742
            ||:...|    ..|:|.:.   ::|.:.....||           :.:.|:|...|.|.|.|.|.
  Rat  2339 VRSEGGE----SVLVVQLE---VLEMLRRPTFRNPFNEKVIAQAGKPVALNCSVDGNPPPEITWI 2396

  Fly   743 KATGSKSGEYEEVRERPFTK---LLGNGSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNS 804
            ...|:      :...||...   :.|||||:|.....::.|.|.|.|.|.:|. |.|:|.|::..
  Rat  2397 LPDGT------QFANRPHNSPYLMAGNGSLILYKATRNKSGKYRCAARNKVGY-IEKLILLEIGQ 2454

  Fly   805 SPYFSSTSRSVMVK--KGDTALLQCAVSGDKPINIVWMRSGKNTLN-PSTNYKISVKQEATPDGV 866
            .|.. .|....|||  .|:...|.|...|....|:.|...|.:.:: |..:.|..:.:..|    
  Rat  2455 KPVI-LTYEPGMVKSVSGEPLSLHCVSDGIPKPNVKWTTPGGHVIDRPQVDGKYILHENGT---- 2514

  Fly   867 SAELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTL 931
               |.|:...|.|.|.|.|||.|..|  |.::.:.|.....||.:            |.:.|:.:
  Rat  2515 ---LVIKATTAHDQGNYICRAQNSVG--QAVISVSVMVVAYPPRI------------INYLPRNM 2562

  Fly   932 --GTGD----------VTKYIVEFREADHSLPPALFVDQWQQIEVKDPPHFNAMIENLKPATRYA 984
              .||:          :.|..|.:....|||.......:..:.|:.. |....:|:||:.:....
  Rat  2563 LRRTGEAMQLHCVALGIPKPKVTWETPRHSLLSKATARKPHRSEMLH-PQGTLVIQNLQTSDSGV 2626

  Fly   985 FRVIAEGSAG 994
            ::..|:...|
  Rat  2627 YKCRAQNLLG 2636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 30..128 CDD:472250 24/88 (27%)
Ig strand B 49..53 CDD:409353 1/3 (33%)
Ig strand C 62..66 CDD:409353 0/3 (0%)
Ig strand E 86..90 CDD:409353 3/3 (100%)
Ig strand F 106..111 CDD:409353 2/4 (50%)
Ig strand G 119..123 CDD:409353 0/3 (0%)
V-set 138..229 CDD:462230 23/101 (23%)
Ig 238..327 CDD:472250 25/91 (27%)
Ig strand B 255..259 CDD:409353 1/4 (25%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 293..297 CDD:409353 1/3 (33%)
Ig strand F 307..312 CDD:409353 2/4 (50%)
Ig strand G 320..323 CDD:409353 0/2 (0%)
Ig 330..418 CDD:472250 24/109 (22%)
Ig strand B 348..352 CDD:409353 0/3 (0%)
Ig strand C 365..369 CDD:409353 1/3 (33%)
Ig strand E 383..387 CDD:409353 1/17 (6%)
Ig strand F 397..402 CDD:409353 2/4 (50%)
Ig strand G 411..414 CDD:409353 0/3 (0%)
IgI_4_Dscam 422..517 CDD:409548 27/100 (27%)
Ig strand A 422..425 CDD:409548 0/2 (0%)
Ig strand A' 431..435 CDD:409548 1/3 (33%)
Ig strand B 438..447 CDD:409548 1/8 (13%)
Ig strand C 452..458 CDD:409548 3/5 (60%)
Ig strand C' 460..463 CDD:409548 1/2 (50%)
Ig strand D 468..476 CDD:409548 1/7 (14%)
Ig strand E 480..489 CDD:409548 1/8 (13%)
Ig strand F 496..504 CDD:409548 4/7 (57%)
Ig strand G 507..517 CDD:409548 2/9 (22%)
IgI_5_Dscam 521..608 CDD:409550 28/95 (29%)
Ig strand A 521..523 CDD:409550 1/1 (100%)
Ig strand A' 528..532 CDD:409550 2/5 (40%)
Ig strand B 535..542 CDD:409550 2/6 (33%)
Ig strand C 549..555 CDD:409550 1/5 (20%)
Ig strand C' 556..558 CDD:409550 0/1 (0%)
Ig strand D 565..569 CDD:409550 1/3 (33%)
Ig strand E 572..578 CDD:409550 2/5 (40%)
Ig strand F 586..594 CDD:409550 4/7 (57%)
Ig strand G 598..608 CDD:409550 0/9 (0%)
Ig 611..704 CDD:472250 16/103 (16%)
Ig strand B 630..634 CDD:409353 0/3 (0%)
Ig strand C 644..648 CDD:409353 0/4 (0%)
Ig strand E 670..674 CDD:409353 1/3 (33%)
Ig strand F 684..689 CDD:409353 1/4 (25%)
Ig strand G 697..700 CDD:409353 0/2 (0%)
IgI_7_Dscam 707..802 CDD:409546 29/108 (27%)
Ig strand A 707..711 CDD:409546 0/3 (0%)
Ig strand A' 716..720 CDD:409546 0/3 (0%)
Ig strand B 723..732 CDD:409546 2/8 (25%)
Ig strand C 738..744 CDD:409546 2/5 (40%)
Ig strand C' 750..753 CDD:409546 0/2 (0%)
Ig strand D 761..764 CDD:409546 0/5 (0%)
Ig strand E 767..773 CDD:409546 4/5 (80%)
Ig strand F 780..788 CDD:409546 4/7 (57%)
Ig strand G 793..802 CDD:409546 4/8 (50%)
Ig 806..892 CDD:472250 25/88 (28%)
Ig strand B 823..827 CDD:409353 1/3 (33%)
Ig strand C 836..840 CDD:409353 1/3 (33%)
Ig strand E 868..872 CDD:409353 1/3 (33%)
Ig strand F 882..887 CDD:409353 2/4 (50%)
FN3 <904..1195 CDD:442628 17/102 (17%)
FN3 906..1006 CDD:238020 17/100 (17%)
fn3 1221..1306 CDD:394996
Ig 1336..1396 CDD:409353
Ig strand B 1336..1340 CDD:409353
Ig strand E 1371..1375 CDD:409353
Ig strand F 1385..1390 CDD:409353
FN3 <1407..>1606 CDD:442628
fn3 1408..1491 CDD:394996
Igsf10XP_038958192.1 LRRNT 78..110 CDD:214470
leucine-rich repeat 89..108 CDD:275380
LRR <98..>282 CDD:443914
leucine-rich repeat 109..132 CDD:275380
leucine-rich repeat 133..156 CDD:275380
leucine-rich repeat 157..180 CDD:275380
leucine-rich repeat 181..204 CDD:275380
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..260 CDD:275380
Ig 532..605 CDD:472250
Ig strand B 543..547 CDD:409353
Ig strand C 556..561 CDD:409353
Ig strand E 584..588 CDD:409353
Ig strand F 598..603 CDD:409353
IG_like 632..712 CDD:214653
Ig strand B 641..645 CDD:409570
Ig strand C 654..658 CDD:409570
Ig strand E 678..682 CDD:409570
Ig strand F 692..697 CDD:409570
Ig strand G 705..708 CDD:409570
DUF5585 <1022..1351 CDD:465521
Herpes_BLLF1 <1189..1500 CDD:282904
Ig 1690..1763 CDD:472250 23/83 (28%)
Ig strand B 1690..1694 CDD:409353 1/3 (33%)
Ig strand C 1703..1707 CDD:409353 0/3 (0%)
Ig strand E 1730..1734 CDD:409353 3/3 (100%)
Ig strand F 1744..1749 CDD:409353 3/10 (30%)
Ig strand G 1758..1761 CDD:409353 0/2 (0%)
Ig 1768..1861 CDD:472250 24/101 (24%)
Ig strand B 1787..1791 CDD:409353 1/3 (33%)
Ig strand C 1800..1804 CDD:409353 3/11 (27%)
Ig strand E 1827..1831 CDD:409353 2/3 (67%)
Ig strand F 1841..1846 CDD:409353 1/4 (25%)
Ig strand G 1854..1857 CDD:409353 0/2 (0%)
Ig 1866..1958 CDD:472250 25/94 (27%)
Ig strand B 1884..1888 CDD:409570 1/3 (33%)
Ig strand C 1897..1902 CDD:409570 1/4 (25%)
Ig strand E 1924..1928 CDD:409570 1/3 (33%)
Ig strand F 1938..1943 CDD:409570 2/4 (50%)
Ig strand G 1951..1954 CDD:409570 1/2 (50%)
Ig_3 1965..2044 CDD:464046 19/87 (22%)
IG_like 2077..2160 CDD:214653 24/85 (28%)
Ig strand B 2080..2084 CDD:409353 0/3 (0%)
Ig strand C 2093..2097 CDD:409353 1/3 (33%)
Ig strand E 2126..2130 CDD:409353 0/3 (0%)
Ig strand F 2140..2145 CDD:409353 2/4 (50%)
Ig strand G 2153..2156 CDD:409353 0/2 (0%)
IG_like 2178..2252 CDD:214653 23/79 (29%)
Ig strand B 2183..2187 CDD:409353 1/3 (33%)
Ig strand C 2196..2200 CDD:409353 1/8 (13%)
Ig strand E 2220..2224 CDD:409353 1/3 (33%)
Ig strand F 2234..2239 CDD:409353 2/4 (50%)
Ig strand G 2247..2250 CDD:409353 0/2 (0%)
IG_like 2283..2354 CDD:214653 14/77 (18%)
Ig strand C 2294..2298 CDD:409353 0/3 (0%)
Ig strand E 2320..2324 CDD:409353 1/3 (33%)
Ig strand F 2334..2339 CDD:409353 1/4 (25%)
Ig_3 2360..2439 CDD:464046 22/84 (26%)
Ig_3 2455..2534 CDD:464046 24/86 (28%)
Ig_3 2551..2633 CDD:464046 17/94 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.