Sequence 1: | NP_001261500.1 | Gene: | Dscam2 / 38788 | FlyBaseID: | FBgn0265296 | Length: | 2101 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_218634.5 | Gene: | Iglon5 / 308557 | RGDID: | 1305344 | Length: | 336 | Species: | Rattus norvegicus |
Alignment Length: | 310 | Identity: | 72/310 - (23%) |
---|---|---|---|
Similarity: | 123/310 - (39%) | Gaps: | 50/310 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 627 GDRASLTCSVVKGDLPLT-INW---------RKDGRPIDPTQHMSVKQVDQYNSILVIENLGSDH 681
Fly 682 TGNYSCVVRNSAAEVENSQALLVNVPPRW--IVEPVDANVERNRHIMLHCQAQGVPTPSIVWKKA 744
Fly 745 TGSKSGEYEEVRERPFTKLLGNGSLL-LQHVKEDREGFYLCQANNGIGTG-IGKVIQLKVNSSPY 807
Fly 808 FSSTSRSVMVKKGDTALLQCAVSGDKPINIVWMRSGKNTLNPSTNYKISVKQEATPDGVSAELQI 872
Fly 873 RTVDATDSGPYFCRASNLYGNDQQLVQL--------QVQEPPLPPSVLEA 914 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dscam2 | NP_001261500.1 | Ig | 51..127 | CDD:299845 | |
Ig | 138..>203 | CDD:299845 | |||
I-set | 238..327 | CDD:254352 | |||
Ig | 247..327 | CDD:299845 | |||
I-set | 332..418 | CDD:254352 | |||
IGc2 | 344..407 | CDD:197706 | |||
IG_like | 432..517 | CDD:214653 | |||
IGc2 | 436..507 | CDD:197706 | |||
I-set | 521..610 | CDD:254352 | |||
IGc2 | 533..597 | CDD:197706 | |||
Ig | 630..699 | CDD:143165 | 14/78 (18%) | ||
IG_like | 714..802 | CDD:214653 | 19/89 (21%) | ||
Ig | 725..802 | CDD:299845 | 15/78 (19%) | ||
Ig | 823..894 | CDD:143165 | 20/70 (29%) | ||
FN3 | 906..1006 | CDD:238020 | 4/9 (44%) | ||
FN3 | 1013..1111 | CDD:238020 | |||
FN3 | 1119..1209 | CDD:238020 | |||
FN3 | 1219..1313 | CDD:238020 | |||
Ig | 1336..1402 | CDD:143165 | |||
FN3 | 1409..1498 | CDD:238020 | |||
FN3 | 1515..1588 | CDD:238020 | |||
Iglon5 | XP_218634.5 | Ig | 41..129 | CDD:416386 | 17/86 (20%) |
Ig strand A' | 41..46 | CDD:409353 | |||
Ig strand B | 48..56 | CDD:409353 | 4/7 (57%) | ||
CDR1 | 56..60 | CDD:409353 | 1/6 (17%) | ||
FR2 | 61..68 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 61..67 | CDD:409353 | 2/5 (40%) | ||
CDR2 | 69..79 | CDD:409353 | 1/9 (11%) | ||
Ig strand C' | 71..74 | CDD:409353 | 0/2 (0%) | ||
Ig strand C' | 76..79 | CDD:409353 | 1/2 (50%) | ||
FR3 | 80..115 | CDD:409353 | 7/36 (19%) | ||
Ig strand D | 84..91 | CDD:409353 | 0/6 (0%) | ||
Ig strand E | 94..100 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 107..115 | CDD:409353 | 3/9 (33%) | ||
CDR3 | 116..120 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 120..129 | CDD:409353 | 1/8 (13%) | ||
FR4 | 122..129 | CDD:409353 | 1/6 (17%) | ||
Ig strand A | 132..137 | CDD:409353 | 2/4 (50%) | ||
Ig_3 | 134..199 | CDD:404760 | 19/81 (23%) | ||
Ig strand A' | 140..145 | CDD:409353 | 2/4 (50%) | ||
Ig strand B | 148..157 | CDD:409353 | 3/10 (30%) | ||
Ig strand C | 163..167 | CDD:409353 | 0/3 (0%) | ||
Ig strand D | 174..177 | CDD:409353 | 1/17 (6%) | ||
Ig strand E | 178..183 | CDD:409353 | 1/4 (25%) | ||
Ig strand F | 191..199 | CDD:409353 | 3/7 (43%) | ||
Ig_3 | 217..295 | CDD:404760 | 21/83 (25%) | ||
putative Ig strand A | 218..224 | CDD:409353 | 1/5 (20%) | ||
Ig strand B | 234..238 | CDD:409353 | 3/3 (100%) | ||
Ig strand C | 247..251 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 301..304 | CDD:409353 | 0/2 (0%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |