DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and l1camb

DIOPT Version :10

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_571458.1 Gene:l1camb / 30656 ZFINID:ZDB-GENE-980526-512 Length:1269 Species:Danio rerio


Alignment Length:1458 Identity:318/1458 - (21%)
Similarity:486/1458 - (33%) Gaps:510/1458 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RGPGFVMEPPGRVEFSNSSGGWLDCSASGSPQPTVDWVHADGSAVTEIHGVRRVLRNGTLVLMPF 93
            :.|.|..:|.....||..... |.|.|||.|.|:..|| .||....|:     :..:|||...|.
Zfish    48 QAPEFTTQPVPHTAFSLDDVN-LACEASGDPSPSFRWV-KDGKQFGEV-----LSESGTLTPHPT 105

  Fly    94 AAAAYHQDVHNTIYRCIASNSVGRIVSRDV-----------QVRAVVAQAYKVDVEVLSAARGCT 147
            ....::|..    |||.|:|.:|..||..|           :|:....:||:|         |.:
Zfish   106 MDLHFYQGT----YRCYAANELGTAVSNLVHLTTEPVPSLAKVKKQKRRAYEV---------GES 157

  Fly   148 AILRCVVPTFVKELVRVVSWVHEPAIYIYPSLQGDGKFHLLP---------TGELLIHNLQESDE 203
            |:|||..|.  ..:...:.|:             |.:||.:|         .|.|...||..:|.
Zfish   158 AVLRCNPPK--SSVTPKIHWM-------------DMQFHHIPLNERVTISRDGNLYFANLIANDS 207

  Fly   204 SQSFRCRSMHRLTRQVVV-SSPTRLRINSHRGIIS--PSVVEHTAHVQ----VSQDEGAVLLCVA 261
            ...:.|.: |.:...::: ..|..:.:.....::.  .:.:.|.|..:    |.:.:...|.|:.
Zfish   208 RDDYTCNA-HYINASIILPKEPMSIYVTPSNSVVKNRRAKLHHPAGARSSYLVLRGQTLTLECIP 271

  Fly   262 QGCPSPEYSWFTHNGAGPLPVLSGPRVRLL--GPILAIEAVTGEDSGVYKCTAGNVGGEASAELR 324
            :|.|:||..|...:.|     ||..|.:.|  ...|.|:.|...|.|.|.|||.|  .|.|.:..
Zfish   272 EGLPTPEVHWDRIDSA-----LSPNRTKKLYNNRWLQIDNVLESDDGEYVCTARN--SENSVKHH 329

  Fly   325 LTVATPIQVEISPNVLSVHMGGTAEFRCLVTSNGSPVGMQNILWYKDGRQLPSSGRVEDTLVVPR 389
            .||.    ||.:|                             .|                     
Zfish   330 YTVT----VEAAP-----------------------------YW--------------------- 340

  Fly   390 VSRENRGMYQCVVRRPEGDTFQATAELQLGDAPPVLLYSFIEQTLQPGPAVSLKCSAAGNPTPQI 454
                        .||||                        |....||..|.|.|.|.|.|.|.|
Zfish   341 ------------TRRPE------------------------EHLYAPGETVRLDCQADGIPAPNI 369

  Fly   455 SWTLDGFPLPSNG-----RFMIGQYITVHGDVISHVNISHVMVEDGGEYACIAENRAGRVQHAAR 514
            :|:::|.|:....     |...|:.|           :|:|...|...|.|.|.|:.|.:.....
Zfish   370 TWSINGVPVSGTDVDPRRRVSSGKLI-----------LSNVEFSDTAVYQCEAVNKHGSILINTH 423

  Fly   515 LNIYGLPYIRLIPK---VTAVSGETLNLKCPVAGYPIEEIHWERGGRELPDDIRQRVQPDGSLTI 576
            :::..||...|.|.   ..|.:|:|:.|.|...|.|:.:|||     |:.|.|            
Zfish   424 VHVVELPAQILTPDERLYQATAGQTVMLDCRTFGSPLPKIHW-----EILDSI------------ 471

  Fly   577 SPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIVPPKLSPFQTNILQLNMGDRASLTCSVVKGDL 641
                                               |.||  ...|.|:.                
Zfish   472 -----------------------------------PALS--NAKISQMT---------------- 483

  Fly   642 PLTINWRKDGRPIDPTQHMSVKQVDQYNSILVIENLGSDHTGNYSCVV----RNSAAEVENSQAL 702
                                       |..|.|.|:..:.:..|:|.|    ::.:||:|.....
Zfish   484 ---------------------------NGSLKISNVSEEDSNRYTCSVSETNKSISAELEVLNRT 521

  Fly   703 LVNVPPRWIVEPVDANVERNRHIMLHCQ---AQGVPTPSIVWK----KATGSKSGE-YEEVRERP 759
            .:..||:      :.:|.|....:|||:   ...:.:|::.||    |.|.|.|.: |.|:    
Zfish   522 KIVGPPQ------NLHVIRGSDAILHCKYTVDHNLKSPTVQWKKDGHKITASTSNDKYHEI---- 576

  Fly   760 FTKLLGNGSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTAL 824
                  .|||.:..|:.:..|.|.|                                        
Zfish   577 ------EGSLKVLDVQMEDMGIYSC---------------------------------------- 595

  Fly   825 LQCAVSGDKPINIVWMRSGKNTLNPSTNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASN 889
                                                    |||.     |:|:..:..|      
Zfish   596 ----------------------------------------GVST-----TLDSDTASGY------ 609

  Fly   890 LYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDVTKYIVEFREADHSLPPAL 954
                      :.||:.|.||..|:.:....|||.|.|.|.......||:|::|..|.:  .|.. 
Zfish   610 ----------ITVQDKPDPPQSLKLSEKMERSVTISWMPSVENNSPVTEYVIEMNEGE--TPDE- 661

  Fly   955 FVDQWQ----------QIEVKDPPHFNAMIENLKPATRYAFRVIAEGSAGRSAPSQ-ELIVRTEP 1008
              .|||          |:|:           :|:|.::|.|::.|..|.|.||||: .|...|..
Zfish   662 --GQWQKYRSVSQDIRQLEI-----------HLQPYSKYHFQIRAVNSIGTSAPSESSLSYSTPA 713

  Fly  1009 QRPAGPP---LSLSARPLSSTELLISWVAPLPELRHGDIQG----YNVGYKLSSSGNTAYNFTSV 1066
            .:|...|   ::||..|.|   ::|||    .|:......|    |.|.::.::.....:..:||
Zfish   714 AKPDRNPENVMTLSTDPKS---MIISW----QEMDRRQFNGPGFQYKVFWRRAADSGAHWTESSV 771

  Fly  1067 SGDGDGGNGELLLSGLAKFARYTVVVQAFNQVGPGPLSEPTAAQTMEDVPSRPPEDVRCAALSSQ 1131
            |      |..||::....|..:.:.|||.|.:|..|........:.||.|...|..:....|...
Zfish   772 S------NPPLLVNNTGTFVSFEIKVQAVNDLGAAPEPLTVIGYSGEDFPLEAPSALSVTELQKT 830

  Fly  1132 SLQVSWQPPPIYHTNGLLQGYKLIF-------------EPIIDDIQPSKDEVESRKTTALTMVLT 1183
            |:.|.|.|.......|.|.|||:..             .|.:.:  |:..||.:   .|...:::
Zfish   831 SVMVRWSPVRPESVRGHLLGYKIYLRMKGPSGRLRAGRSPAVGN--PTVIEVPA---DAAEKIVS 890

  Fly  1184 GLRKYTNYSIQVLAHTRMGDGVVSKPLFCHSEE---DVPE-APADIKVV---SSSSQSLYISWLP 1241
            .|:.|::|::.:.|....|:|.       ||||   ..|| ||..:..:   |.|...:.:.|..
Zfish   891 DLQYYSDYTLTITAFNSKGEGP-------HSEESSFSTPEGAPGPVLFLPFDSPSESEITLRWEA 948

  Fly  1242 PNEPNGVITKYSL-YTRVVNGREELNN-EKRSLPSQQAYYEAKGLHPHMEYQFWVTASTRVGEGK 1304
            |::|||.|..|.| |..||.|.|...: |...||: ...:..|.|:|...|.|.::|....|:|.
Zfish   949 PHKPNGEIRGYLLQYQEVVIGSESPQHVESIDLPA-VTEFTLKNLNPESRYTFHLSARNSAGDGA 1012

  Fly  1305 SSRVSSQITTNRIPARIISFGGPVVRPWRSTVTLPCTA------VGKPKR--------EWFKSDV 1355
            .:..|.....:..|..:|:     :....::|.|....      ||...|        ||.:|:.
Zfish  1013 PAIQSGATLLDGEPPSVIN-----MTAGETSVNLSWVPGDRHRNVGFSFRYLKKIEGAEWEESEK 1072

  Fly  1356 ALRQGGLHNSQLLDSGDLIISSLQLADG 1383
            .......:..|.||||  :|..||:..|
Zfish  1073 INSTQAFYQLQGLDSG--VIYHLQVLSG 1098

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 30..128 CDD:472250 32/108 (30%)
Ig strand B 49..53 CDD:409353 1/3 (33%)
Ig strand C 62..66 CDD:409353 0/3 (0%)
Ig strand E 86..90 CDD:409353 3/3 (100%)
Ig strand F 106..111 CDD:409353 3/4 (75%)
Ig strand G 119..123 CDD:409353 2/3 (67%)
V-set 138..229 CDD:462230 19/100 (19%)
Ig 238..327 CDD:472250 27/94 (29%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 1/3 (33%)
Ig strand E 293..297 CDD:409353 1/3 (33%)
Ig strand F 307..312 CDD:409353 2/4 (50%)
Ig strand G 320..323 CDD:409353 1/2 (50%)
Ig 330..418 CDD:472250 8/87 (9%)
Ig strand B 348..352 CDD:409353 0/3 (0%)
Ig strand C 365..369 CDD:409353 0/3 (0%)
Ig strand E 383..387 CDD:409353 0/3 (0%)
Ig strand F 397..402 CDD:409353 0/4 (0%)
Ig strand G 411..414 CDD:409353 0/2 (0%)
IgI_4_Dscam 422..517 CDD:409548 25/99 (25%)
Ig strand A 422..425 CDD:409548 0/2 (0%)
Ig strand A' 431..435 CDD:409548 1/3 (33%)
Ig strand B 438..447 CDD:409548 3/8 (38%)
Ig strand C 452..458 CDD:409548 3/5 (60%)
Ig strand C' 460..463 CDD:409548 1/2 (50%)
Ig strand D 468..476 CDD:409548 2/7 (29%)
Ig strand E 480..489 CDD:409548 0/8 (0%)
Ig strand F 496..504 CDD:409548 3/7 (43%)
Ig strand G 507..517 CDD:409548 1/9 (11%)
IgI_5_Dscam 521..608 CDD:409550 16/89 (18%)
Ig strand A 521..523 CDD:409550 1/1 (100%)
Ig strand A' 528..532 CDD:409550 0/6 (0%)
Ig strand B 535..542 CDD:409550 2/6 (33%)
Ig strand C 549..555 CDD:409550 3/5 (60%)
Ig strand C' 556..558 CDD:409550 0/1 (0%)
Ig strand D 565..569 CDD:409550 0/3 (0%)
Ig strand E 572..578 CDD:409550 0/5 (0%)
Ig strand F 586..594 CDD:409550 0/7 (0%)
Ig strand G 598..608 CDD:409550 0/9 (0%)
Ig 611..704 CDD:472250 15/96 (16%)
Ig strand B 630..634 CDD:409353 0/3 (0%)
Ig strand C 644..648 CDD:409353 0/3 (0%)
Ig strand E 670..674 CDD:409353 1/3 (33%)
Ig strand F 684..689 CDD:409353 2/4 (50%)
Ig strand G 697..700 CDD:409353 1/2 (50%)
IgI_7_Dscam 707..802 CDD:409546 23/102 (23%)
Ig strand A 707..711 CDD:409546 2/3 (67%)
Ig strand A' 716..720 CDD:409546 0/3 (0%)
Ig strand B 723..732 CDD:409546 3/11 (27%)
Ig strand C 738..744 CDD:409546 2/9 (22%)
Ig strand C' 750..753 CDD:409546 0/3 (0%)
Ig strand D 761..764 CDD:409546 0/2 (0%)
Ig strand E 767..773 CDD:409546 3/5 (60%)
Ig strand F 780..788 CDD:409546 3/7 (43%)
Ig strand G 793..802 CDD:409546 0/8 (0%)
Ig 806..892 CDD:472250 6/85 (7%)
Ig strand B 823..827 CDD:409353 0/3 (0%)
Ig strand C 836..840 CDD:409353 0/3 (0%)
Ig strand E 868..872 CDD:409353 0/3 (0%)
Ig strand F 882..887 CDD:409353 1/4 (25%)
FN3 <904..1195 CDD:442628 82/321 (26%)
FN3 906..1006 CDD:238020 33/110 (30%)
fn3 1221..1306 CDD:394996 28/89 (31%)
Ig 1336..1396 CDD:409353 17/62 (27%)
Ig strand B 1336..1340 CDD:409353 2/3 (67%)
Ig strand E 1371..1375 CDD:409353 1/3 (33%)
Ig strand F 1385..1390 CDD:409353
FN3 <1407..>1606 CDD:442628
fn3 1408..1491 CDD:394996
l1cambNP_571458.1 Ig 50..133 CDD:472250 31/93 (33%)
Ig strand B 67..71 CDD:409353 1/4 (25%)
Ig strand C 80..84 CDD:409353 0/3 (0%)
Ig strand E 98..101 CDD:409353 2/2 (100%)
Ig strand F 114..119 CDD:409353 3/8 (38%)
Ig strand G 128..131 CDD:409353 1/2 (50%)
Ig 146..233 CDD:472250 22/111 (20%)
Ig strand B 158..162 CDD:409353 2/3 (67%)
Ig strand C 172..176 CDD:409353 0/3 (0%)
Ig strand E 195..199 CDD:409353 2/3 (67%)
Ig strand F 210..215 CDD:409353 1/4 (25%)
Ig strand G 226..229 CDD:409353 0/2 (0%)
Ig3_L1-CAM 253..335 CDD:409460 27/92 (29%)
Ig strand B 265..269 CDD:409460 1/3 (33%)
Ig strand C 278..282 CDD:409460 1/3 (33%)
Ig strand E 300..304 CDD:409460 1/3 (33%)
Ig strand F 314..319 CDD:409460 2/4 (50%)
Ig strand G 327..330 CDD:409460 0/2 (0%)
Ig 339..427 CDD:472250 30/155 (19%)
Ig strand B 355..359 CDD:409353 2/3 (67%)
Ig strand C 368..372 CDD:409353 1/3 (33%)
Ig strand E 392..396 CDD:409353 2/14 (14%)
Ig strand F 406..411 CDD:409353 2/4 (50%)
Ig strand G 419..422 CDD:409353 0/2 (0%)
IG_like 441..517 CDD:214653 27/172 (16%)
Ig strand B 449..453 CDD:409353 1/3 (33%)
Ig strand C 462..467 CDD:409353 3/9 (33%)
Ig strand E 485..489 CDD:409353 1/3 (33%)
Ig strand G 510..513 CDD:409353 0/2 (0%)
Ig 523..612 CDD:472250 29/205 (14%)
Ig strand B 538..542 CDD:409353 1/3 (33%)
Ig strand C 554..558 CDD:409353 0/3 (0%)
Ig strand E 578..582 CDD:409353 3/3 (100%)
Ig strand F 592..597 CDD:409353 2/84 (2%)
Ig strand G 605..608 CDD:409353 0/2 (0%)
FN3 616..706 CDD:238020 32/105 (30%)
FN3 719..798 CDD:214495 23/91 (25%)
FN3 817..921 CDD:238020 26/115 (23%)
FN3 926..1014 CDD:238020 27/88 (31%)
FN3 1025..>1095 CDD:238020 17/76 (22%)
Bravo_FIGEY 1148..1233 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.