DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and Il18r1

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_001100375.1 Gene:Il18r1 / 301365 RGDID:1308589 Length:537 Species:Rattus norvegicus


Alignment Length:552 Identity:102/552 - (18%)
Similarity:176/552 - (31%) Gaps:197/552 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 WFTHN---GAGPLPVLSGPRVRLLGPILAIEAVTGEDSGVYKCTAGNVGGEASAELRLT------ 326
            ||..|   |...|.:.|.||:...|..|....|..||.|.|....||  ...:..|.:|      
  Rat    57 WFKGNASHGYRELNMRSSPRIAFHGHALEFWPVELEDKGTYFSQVGN--DRQNWTLNVTKRNKHS 119

  Fly   327 -----VATPIQVEISPNVLSVHMGGTAEFRCLVTSNGSPVG--MQNILWYKDGRQLPSSGRVEDT 384
                 :.|...||:..::             .:|......|  :.:.|.||:.:::..:      
  Rat   120 CFSEKLVTNRDVEVKKSL-------------WITCENPSYGELINHTLLYKNCKEISKT------ 165

  Fly   385 LVVPRVSRE----NRGMYQCVVR-RPEGDTFQATAELQL----GDA---PPVLLYSFIEQTLQPG 437
               |.:.::    :.|.|.||.. ...|..:..|..:.:    |::   |.:......:..::.|
  Rat   166 ---PMILKDAEFGDEGYYSCVFSVHHNGQQYNITKTVNITVIEGNSKITPAIFGSKSAKVGVELG 227

  Fly   438 PAVSLKCSAAGNPTPQISWTL---DGFPLPSNGRFMIGQYITVHGDVISHVNISHVMVEDGGEYA 499
            ..|.|.|||..|......|::   |.  |..|          ||              ||..|..
  Rat   228 EDVELNCSAVLNRNDLFYWSIRKEDS--LDPN----------VH--------------EDRNETT 266

  Fly   500 CIAENRAGRVQHAARLNIYGLPYIRLIPKVTAVSGETLNL--KCPVAGYPIEEIHWERG----GR 558
            ...|.:.    ||::           |.::..|:.:.||:  .|.||.   ||....:.    .:
  Rat   267 WTFEGKL----HASK-----------ILRIQKVTEKYLNVLYNCTVAN---EEATDTKSFILVRK 313

  Fly   559 ELPDDIRQRVQPDGSLTISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIVPPKLSPFQTNILQ 623
            |.||                                .|||...|.  :|::|...::.....|| 
  Rat   314 ETPD--------------------------------IQGHVFMRG--ITMVVLTSVAAVCVVIL- 343

  Fly   624 LNMGDRASLTCSVVKGDLPLTINWRK---------DGRPIDP----TQHMSVKQVDQYN-SILVI 674
                      |.:.|.||.|.  :|:         ||:..|.    .:....:..::|. ::..:
  Rat   344 ----------CIIYKVDLVLF--YRRVAERDETLTDGKTYDAFVSYLRECHPENGEEYTFAVETL 396

  Fly   675 ENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWIVEPVDANVERNRHIMLHCQAQGVPTPSI 739
            ..:.....|...|:.....            ||...:|:.:.:.:|::|.::            |
  Rat   397 PRVLEKQFGYKLCIFERDV------------VPGGAVVDEIHSLIEKSRRLI------------I 437

  Fly   740 VWKKA---TGSK----SGEYEEVRERPFTKLL 764
            |..|:   .||:    ||.::.:.||....:|
  Rat   438 VLSKSYMTNGSRLELESGLHQALVERKIKIIL 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352 19/69 (28%)
Ig 247..327 CDD:299845 19/69 (28%)
I-set 332..418 CDD:254352 14/92 (15%)
IGc2 344..407 CDD:197706 10/69 (14%)
IG_like 432..517 CDD:214653 19/87 (22%)
IGc2 436..507 CDD:197706 17/73 (23%)
I-set 521..610 CDD:254352 17/94 (18%)
IGc2 533..597 CDD:197706 10/69 (14%)
Ig 630..699 CDD:143165 12/82 (15%)
IG_like 714..802 CDD:214653 12/58 (21%)
Ig 725..802 CDD:299845 10/47 (21%)
Ig 823..894 CDD:143165
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Il18r1NP_001100375.1 Ig_2 22..112 CDD:290606 18/56 (32%)
Ig <156..205 CDD:299845 9/57 (16%)
IG_like 224..310 CDD:214653 28/129 (22%)
TIR 370..519 CDD:214587 19/124 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.