Sequence 1: | NP_001261500.1 | Gene: | Dscam2 / 38788 | FlyBaseID: | FBgn0265296 | Length: | 2101 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038944182.1 | Gene: | Lsamp / 29561 | RGDID: | 71102 | Length: | 378 | Species: | Rattus norvegicus |
Alignment Length: | 387 | Identity: | 91/387 - (23%) |
---|---|---|---|
Similarity: | 147/387 - (37%) | Gaps: | 103/387 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 224 PTRLRINSHRGIISPSVVEHTAHVQVSQDEGAVLLCVAQGCPSPEYSWFTHNGAGPLPVLSG--- 285
Fly 286 ----PRVRL-----LGPILAIEAVTGEDSGVYKCTAGNVGGEASAELRLTVATPIQVEISPNVLS 341
Fly 342 VHMGGTAEFRCLVTSNGSPVGMQNILWYKDGRQLPSSGR----VEDTLVVPRVSRENRGMYQCVV 402
Fly 403 RRPEGDTFQATAELQLGDA---------PPVLLYSFIEQTLQPGPAVSLKCSAAGNPTPQISWTL 458
Fly 459 DGFPLPS-NG---RFMIGQYITVHGDVISHVNISHVMVEDGGEYACIAENRAGRVQHAARLNIYG 519
Fly 520 LPYIRLIPKVTAVSGETLNLKCPVAGYPIEEI----HWERGGRELPDDIRQRVQPDGSLTIS 577 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dscam2 | NP_001261500.1 | Ig | 51..127 | CDD:299845 | |
Ig | 138..>203 | CDD:299845 | |||
I-set | 238..327 | CDD:254352 | 23/100 (23%) | ||
Ig | 247..327 | CDD:299845 | 22/91 (24%) | ||
I-set | 332..418 | CDD:254352 | 20/89 (22%) | ||
IGc2 | 344..407 | CDD:197706 | 17/66 (26%) | ||
IG_like | 432..517 | CDD:214653 | 24/88 (27%) | ||
IGc2 | 436..507 | CDD:197706 | 23/74 (31%) | ||
I-set | 521..610 | CDD:254352 | 14/61 (23%) | ||
IGc2 | 533..597 | CDD:197706 | 12/49 (24%) | ||
Ig | 630..699 | CDD:143165 | |||
IG_like | 714..802 | CDD:214653 | |||
Ig | 725..802 | CDD:299845 | |||
Ig | 823..894 | CDD:143165 | |||
FN3 | 906..1006 | CDD:238020 | |||
FN3 | 1013..1111 | CDD:238020 | |||
FN3 | 1119..1209 | CDD:238020 | |||
FN3 | 1219..1313 | CDD:238020 | |||
Ig | 1336..1402 | CDD:143165 | |||
FN3 | 1409..1498 | CDD:238020 | |||
FN3 | 1515..1588 | CDD:238020 | |||
Lsamp | XP_038944182.1 | Ig | 55..145 | CDD:416386 | 23/94 (24%) |
FR1 | 55..71 | CDD:409353 | 5/15 (33%) | ||
Ig strand A' | 56..62 | CDD:409353 | 1/5 (20%) | ||
Ig strand B | 64..72 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 72..76 | CDD:409353 | 0/4 (0%) | ||
FR2 | 77..84 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 77..83 | CDD:409353 | 1/5 (20%) | ||
CDR2 | 85..95 | CDD:409353 | 2/13 (15%) | ||
Ig strand C' | 87..90 | CDD:409353 | 0/6 (0%) | ||
Ig strand C' | 92..95 | CDD:409353 | 0/2 (0%) | ||
FR3 | 96..131 | CDD:409353 | 12/34 (35%) | ||
Ig strand D | 100..107 | CDD:409353 | 3/6 (50%) | ||
Ig strand E | 110..116 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 123..131 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 132..136 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 136..145 | CDD:409353 | 1/8 (13%) | ||
FR4 | 138..145 | CDD:409353 | 1/6 (17%) | ||
Ig_3 | 148..218 | CDD:404760 | 20/87 (23%) | ||
Ig strand A' | 155..160 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 166..173 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 179..184 | CDD:409353 | 3/12 (25%) | ||
Ig strand D | 190..193 | CDD:409353 | 1/2 (50%) | ||
Ig strand E | 197..203 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 210..217 | CDD:409353 | 3/16 (19%) | ||
Ig strand G | 224..232 | CDD:409353 | 1/7 (14%) | ||
Ig_3 | 235..311 | CDD:404760 | 25/85 (29%) | ||
Ig strand B | 252..256 | CDD:409353 | 2/3 (67%) | ||
Ig strand C | 265..269 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 290..294 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 304..309 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 318..321 | CDD:409353 | 1/2 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |