DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and IGSF10

DIOPT Version :10

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:XP_011511010.1 Gene:IGSF10 / 285313 HGNCID:26384 Length:2695 Species:Homo sapiens


Alignment Length:986 Identity:251/986 - (25%)
Similarity:380/986 - (38%) Gaps:206/986 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HLRGPGFVMEPPGRV------EFSNSSGGW--LDCSASGSPQPTVDWVHADGSAVTE-IHGVRR- 81
            ||.....|:..|.|:      |.:..||..  |.|.|.|.|.|||.|:.|:.:.|:| ..|.|: 
Human  1805 HLHVTLSVVSYPPRILERRTKEITVHSGSTVELKCRAEGRPSPTVTWILANQTVVSESSQGSRQA 1869

  Fly    82 -VLRNGTLVLMPFAAAAYHQDVHNT------IYRCIASNSVGRIVSRDVQVRAVVAQAYKVDV-- 137
             |..:|||||            ||.      .|:|:|||..|: .|..|:::.:.|....::.  
Human  1870 VVTVDGTLVL------------HNLSIYDRGFYKCVASNPGGQ-DSLLVKIQVIAAPPVILEQRR 1921

  Fly   138 EVLSAARGCTAILRCVV-----PTFVKELVRVVSWVHEPAIYIYPSLQGDGKFHLLPTGELLIHN 197
            :|:....|.:..|.|..     |:        |.||......:.|....:.|..|...|.|.|.|
Human  1922 QVIVGTWGESLKLPCTAKGTPQPS--------VYWVLSDGTEVKPLQFTNSKLFLFSNGTLYIRN 1978

  Fly   198 LQESDESQSFRC---------RSMHRLTRQVVVSSPTRLRINSHRGIISPSVVEHTAHVQVSQDE 253
            |..||.. ::.|         |.:..||.:..|:|| |:...|.:            ..:|:..:
Human  1979 LASSDRG-TYECIATSSTGSERRVVMLTMEERVTSP-RIEAASQK------------RTEVNFGD 2029

  Fly   254 GAVLLCVAQGCPSPEYSW----------------FTH---NGAGPLPVLSGPRVRLLGPILAIEA 299
            ..:|.|.|.|.|.|:..|                :.|   ||:                 |.|.:
Human  2030 KLLLNCSATGEPKPQIMWRLPSKAVVDQQHRVGSWIHVYPNGS-----------------LFIGS 2077

  Fly   300 VTGEDSGVYKCTAGNVGGE----ASAELRLTVATPIQVEISPNVLSVHMGGTAEFRCLVTSNGSP 360
            ||.:|||||.|.|.|..|:    ....|||   .|.:::.........:.| .:|:....::|||
Human  2078 VTEKDSGVYLCVARNKMGDDLILMHVSLRL---KPAKIDHKQYFRKQVLHG-KDFQVDCKASGSP 2138

  Fly   361 VGMQNILW-YKDGRQLPSSGRVED--------------TLVVPRVSRENRGMYQCVVRRPEGDTF 410
            |  ..|.| ..||..:.::.:.:|              ||...:|.....|.|.|..:...|...
Human  2139 V--PEISWSLPDGTMINNAMQADDSGHRTRRYTLFNNGTLYFNKVGVAEEGDYTCYAQNTLGKDE 2201

  Fly   411 QATAELQLGDAPPVLLYSFIEQTLQPGPAVSLKCSAAGNPTPQISWTLDGFPLPSNG--RFMIGQ 473
            .......:..||.:...:...:.::.|....|.|...|:|.|:|.|.     ||||.  .|.|.:
Human  2202 MKVHLTVITAAPRIRQSNKTNKRIKAGDTAVLDCEVTGDPKPKIFWL-----LPSNDMISFSIDR 2261

  Fly   474 YITVHGDVISHVNISHVMVEDGGEYACIAENRAGRVQHAARLNIYGLPYI-------RLIPKVTA 531
            | |.|.:  ..:.|:.|.:.|.|||.|:|.|.:|......:|::...|.:       |.:.|.||
Human  2262 Y-TFHAN--GSLTINKVKLLDSGEYVCVARNPSGDDTKMYKLDVVSKPPLINGLYTNRTVIKATA 2323

  Fly   532 VSGETLNLKCPVAGYPIEEIHWERGGRELPDDI---------RQRVQPDGSLTISPVQKNSDSGV 587
            |.....:..|...|.|..|:.|     .:||:|         |..|..:|:|.|..| :.|||..
Human  2324 VRHSKKHFDCRAEGTPSPEVMW-----IMPDNIFLTAPYYGSRITVHKNGTLEIRNV-RLSDSAD 2382

  Fly   588 YTCWARNKQGHSARRSGEVTVIV---------PPKLSPFQTNILQLNMGDRASLTCSVVKGDLPL 643
            :.|.|||:.|.|      |.|:.         |...:||...|: ..:|...:|.|| |.|:.|.
Human  2383 FICVARNEGGES------VLVVQLEVLEMLRRPTFRNPFNEKIV-AQLGKSTALNCS-VDGNPPP 2439

  Fly   644 TINWRKDGRPIDP--TQHMSVKQVDQY----NSILVIENLGSDHTGNYSCVVRNSAAEVENSQAL 702
            .|.|      |.|  |:..:..|..||    |...:|.....:..|.|.|..||....:|....|
Human  2440 EIIW------ILPNGTRFSNGPQSYQYLIASNGSFIISKTTREDAGKYRCAARNKVGYIEKLVIL 2498

  Fly   703 LVNVPPRWIV-EPVDANVERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTK---- 762
            .:...|..:. .|..........:.|||.:.|:|.|:|.|...:|       .|.:||...    
Human  2499 EIGQKPVILTYAPGTVKGISGESLSLHCVSDGIPKPNIKWTMPSG-------YVVDRPQINGKYI 2556

  Fly   763 LLGNGSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSPYFSS-TSRSVMVKKGDTALLQ 826
            |..||:|:::.......|.|:|:|.|.:|..:..|..:.|...|..:: ..||::.:.|....|.
Human  2557 LHDNGTLVIKEATAYDRGNYICKAQNSVGHTLITVPVMIVAYPPRITNRPPRSIVTRTGAAFQLH 2621

  Fly   827 CAVSGDKPINIVWMRSGKNTLNPSTNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLY 891
            |...|.....|.|.....:.|:.::..:....::....|.   |.|:....:|||.|.|.|.|..
Human  2622 CVALGVPKPEITWEMPDHSLLSTASKERTHGSEQLHLQGT---LVIQNPQTSDSGIYKCTAKNPL 2683

  Fly   892 GNDQQLVQLQV 902
            |:|.....:||
Human  2684 GSDYAATYIQV 2694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 30..128 CDD:472250 36/114 (32%)
Ig strand B 49..53 CDD:409353 1/5 (20%)
Ig strand C 62..66 CDD:409353 2/3 (67%)
Ig strand E 86..90 CDD:409353 3/3 (100%)
Ig strand F 106..111 CDD:409353 2/4 (50%)
Ig strand G 119..123 CDD:409353 1/3 (33%)
V-set 138..229 CDD:462230 26/104 (25%)
Ig 238..327 CDD:472250 27/111 (24%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 1/19 (5%)
Ig strand E 293..297 CDD:409353 1/3 (33%)
Ig strand F 307..312 CDD:409353 3/4 (75%)
Ig strand G 320..323 CDD:409353 0/2 (0%)
Ig 330..418 CDD:472250 19/102 (19%)
Ig strand B 348..352 CDD:409353 1/3 (33%)
Ig strand C 365..369 CDD:409353 2/4 (50%)
Ig strand E 383..387 CDD:409353 3/17 (18%)
Ig strand F 397..402 CDD:409353 2/4 (50%)
Ig strand G 411..414 CDD:409353 0/2 (0%)
IgI_4_Dscam 422..517 CDD:409548 29/96 (30%)
Ig strand A 422..425 CDD:409548 1/2 (50%)
Ig strand A' 431..435 CDD:409548 0/3 (0%)
Ig strand B 438..447 CDD:409548 2/8 (25%)
Ig strand C 452..458 CDD:409548 3/5 (60%)
Ig strand C' 460..463 CDD:409548 0/2 (0%)
Ig strand D 468..476 CDD:409548 3/7 (43%)
Ig strand E 480..489 CDD:409548 1/8 (13%)
Ig strand F 496..504 CDD:409548 5/7 (71%)
Ig strand G 507..517 CDD:409548 2/9 (22%)
IgI_5_Dscam 521..608 CDD:409550 30/102 (29%)
Ig strand A 521..523 CDD:409550 1/1 (100%)
Ig strand A' 528..532 CDD:409550 2/3 (67%)
Ig strand B 535..542 CDD:409550 0/6 (0%)
Ig strand C 549..555 CDD:409550 2/5 (40%)
Ig strand C' 556..558 CDD:409550 0/1 (0%)
Ig strand D 565..569 CDD:409550 1/3 (33%)
Ig strand E 572..578 CDD:409550 3/5 (60%)
Ig strand F 586..594 CDD:409550 2/7 (29%)
Ig strand G 598..608 CDD:409550 2/9 (22%)
Ig 611..704 CDD:472250 28/98 (29%)
Ig strand B 630..634 CDD:409353 1/3 (33%)
Ig strand C 644..648 CDD:409353 1/3 (33%)
Ig strand E 670..674 CDD:409353 0/3 (0%)
Ig strand F 684..689 CDD:409353 2/4 (50%)
Ig strand G 697..700 CDD:409353 1/2 (50%)
IgI_7_Dscam 707..802 CDD:409546 25/99 (25%)
Ig strand A 707..711 CDD:409546 1/3 (33%)
Ig strand A' 716..720 CDD:409546 0/3 (0%)
Ig strand B 723..732 CDD:409546 3/8 (38%)
Ig strand C 738..744 CDD:409546 2/5 (40%)
Ig strand C' 750..753 CDD:409546 0/2 (0%)
Ig strand D 761..764 CDD:409546 0/6 (0%)
Ig strand E 767..773 CDD:409546 2/5 (40%)
Ig strand F 780..788 CDD:409546 4/7 (57%)
Ig strand G 793..802 CDD:409546 1/8 (13%)
Ig 806..892 CDD:472250 20/86 (23%)
Ig strand B 823..827 CDD:409353 1/3 (33%)
Ig strand C 836..840 CDD:409353 1/3 (33%)
Ig strand E 868..872 CDD:409353 1/3 (33%)
Ig strand F 882..887 CDD:409353 2/4 (50%)
FN3 <904..1195 CDD:442628
FN3 906..1006 CDD:238020
fn3 1221..1306 CDD:394996
Ig 1336..1396 CDD:409353
Ig strand B 1336..1340 CDD:409353
Ig strand E 1371..1375 CDD:409353
Ig strand F 1385..1390 CDD:409353
FN3 <1407..>1606 CDD:442628
fn3 1408..1491 CDD:394996
IGSF10XP_011511010.1 leucine-rich repeat 111..130 CDD:275380
LRR <120..>292 CDD:443914
leucine-rich repeat 131..154 CDD:275380
leucine-rich repeat 155..178 CDD:275380
leucine-rich repeat 179..202 CDD:275380
leucine-rich repeat 203..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 260..282 CDD:275380
PCC 264..>389 CDD:188093
Ig 554..627 CDD:472250
Ig strand B 565..569 CDD:409544
Ig strand C 578..583 CDD:409544
Ig strand E 606..610 CDD:409544
Ig strand F 620..625 CDD:409544
IG_like 654..734 CDD:214653
Ig strand B 663..667 CDD:409353
Ig strand C 676..680 CDD:409353
Ig strand E 700..704 CDD:409353
Ig strand F 714..719 CDD:409353
Ig strand G 728..731 CDD:409353
Herpes_BLLF1 <1365..1739 CDD:282904
Ig 1728..1812 CDD:472250 2/6 (33%)
Ig strand B 1738..1742 CDD:409544
Ig strand C 1751..1755 CDD:409544
Ig strand E 1778..1782 CDD:409544
Ig strand F 1792..1797 CDD:409544
Ig strand G 1805..1808 CDD:409544 2/2 (100%)
Ig 1816..1909 CDD:472250 35/105 (33%)
Ig strand B 1835..1839 CDD:409561 1/3 (33%)
Ig strand C 1848..1852 CDD:409561 2/3 (67%)
Ig strand E 1875..1879 CDD:409561 3/3 (100%)
Ig strand F 1889..1894 CDD:409561 2/4 (50%)
Ig strand G 1902..1905 CDD:409561 1/2 (50%)
Ig_3 1913..1992 CDD:464046 19/87 (22%)
Ig_3 2013..2092 CDD:464046 25/108 (23%)
Ig 2122..2208 CDD:472250 18/88 (20%)
Ig strand B 2128..2132 CDD:409421 1/3 (33%)
Ig strand C 2141..2145 CDD:409421 1/3 (33%)
Ig strand E 2174..2178 CDD:409421 2/3 (67%)
Ig strand F 2188..2193 CDD:409421 2/4 (50%)
Ig strand G 2201..2204 CDD:409421 0/2 (0%)
Ig 2213..2296 CDD:472250 28/90 (31%)
Ig strand B 2231..2235 CDD:409544 1/3 (33%)
Ig strand C 2244..2248 CDD:409544 1/3 (33%)
Ig strand E 2268..2272 CDD:409544 0/3 (0%)
Ig strand F 2282..2287 CDD:409544 3/4 (75%)
Ig strand G 2295..2298 CDD:409544 0/2 (0%)
Ig <2333..2402 CDD:472250 25/80 (31%)
Ig strand C 2342..2346 CDD:409544 2/8 (25%)
Ig strand E 2368..2372 CDD:409544 2/3 (67%)
Ig strand F 2382..2387 CDD:409544 1/4 (25%)
Ig strand G 2395..2398 CDD:409544 1/2 (50%)
Ig_3 2408..2487 CDD:464046 24/86 (28%)
Ig_3 2503..2582 CDD:464046 22/85 (26%)
Ig_3 2599..2681 CDD:464046 19/84 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.