DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and PRTG

DIOPT Version :10

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_776175.2 Gene:PRTG / 283659 HGNCID:26373 Length:1150 Species:Homo sapiens


Alignment Length:1020 Identity:234/1020 - (22%)
Similarity:402/1020 - (39%) Gaps:199/1020 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 LPYIRLIPKVTAVSGETLNLKCPVAGYPIEEIHWERGGRELPDDIRQRVQPDGSLTISPVQ---- 580
            |.:::....||....:.:.|.|...|....::.|.:.|.::.::.|..|..:|||.||.|:    
Human    39 LSFVKEPQDVTVTRKDPVVLDCQAHGEVPIKVTWLKNGAKMSENKRIEVLSNGSLYISEVEGRRG 103

  Fly   581 KNSDSGVYTCWARNKQGH--SARRSGEVTVIVPPKLSPFQTNILQLNMGDRASLTCSVVKGDLPL 643
            :.||.|.|.|.|.||.|.  |.:....::.|...::.|..|   :::.|..|...|. :....|.
Human   104 EQSDEGFYQCLAMNKYGAILSQKAHLALSTISAFEVQPIST---EVHEGGVARFACK-ISSHPPA 164

  Fly   644 TINWRKDGRPIDPTQHMSVKQVDQY-NSILVIENLGSDHTGNYSCVVRNSAAEVENSQALLVNVP 707
            .|.|..:    ..|..|::.::... ..:|.|.::....:|||.|:....|...::.:|.|..:|
Human   165 VITWEFN----RTTLPMTMDRITALPTGVLQIYDVSQRDSGNYRCIAATVAHRRKSMEASLTVIP 225

  Fly   708 ---------PRWIVEPVDANVERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKL 763
                     |..|..|.:.....::.::|.|.|.|.|.|.|.|.:........:.       |::
Human   226 AKESKSFHTPTIIAGPQNITTSLHQTVVLECMATGNPKPIISWSRLDHKSIDVFN-------TRV 283

  Fly   764 LGNGSLLLQHVKEDREGFYLCQANN-GIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQC 827
            ||||:|::..|:....|.|:|:|.. |.......:..|.|.:.|.|.....|:...:..||...|
Human   284 LGNGNLMISDVRLQHAGVYVCRATTPGTRNFTVAMATLTVLAPPSFVEWPESLTRPRAGTARFVC 348

  Fly   828 AVSGDKPINIVWMRSGKNTLNPSTNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYG 892
            ...|.....:.|:::|:..   .:|.:|.:        .:::|.|..:...|...|.|.|.|..|
Human   349 QAEGIPSPKMSWLKNGRKI---HSNGRIKM--------YNSKLVINQIIPEDDAIYQCMAENSQG 402

  Fly   893 NDQQLVQLQV---QEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDVTKYIVEFREADHSLPPAL 954
            :.....:|.|   ::.|..|..:.|..:||.::.:.|:.....:..|..|.|.:.:|:     .|
Human   403 SILSRARLTVVMSEDRPSAPYNVHAETMSSSAILLAWERPLYNSDKVIAYSVHYMKAE-----GL 462

  Fly   955 FVDQWQQIEVKDPPHFNAMIENLKPATRYAFRVIAEGSAGRSAPSQELIVRTEPQRPAGPP-LSL 1018
            ..:::|.:...|..|:  :|::|:||:.|.|.::|....|.|..|..:...|....|..|| :||
Human   463 NNEEYQVVIGNDTTHY--IIDDLEPASNYTFYIVAYMPMGASQMSDHVTQNTLEDVPLRPPEISL 525

  Fly  1019 SARPLSSTELLISWVAPLP-ELRHGDIQGYNVGYKLSSSGNTAYNFTSVSGDGDGGNGELLLSGL 1082
            ::|  |.|::||||: |:| :.|.|.:..|.:.::||:.     |...|. :..|...|.||.||
Human   526 TSR--SPTDILISWL-PIPAKYRRGQVVLYRLSFRLSTE-----NSIQVL-ELPGTTHEYLLEGL 581

  Fly  1083 AKFARYTVVVQAFNQVGPGPLSEPTAAQTMEDVPSRPPE--DVRCAALSSQSLQVSWQPPPIYHT 1145
            ...:.|.|.:.|..:||.|..|..|:.:|.:....:.|:  ::....|:..::.|.||..  ...
Human   582 KPDSVYLVRITAATRVGLGESSVWTSHRTPKATSVKAPKSPELHLEPLNCTTISVRWQQD--VED 644

  Fly  1146 NGLLQGYKLIFE--------PIIDDIQPSKDEVESRKTTALTMVLTGLRKYTNYSIQVLAHTRMG 1202
            ...:|||||.::        ||..|   :||         |...|:||.....|.:::||:..:.
Human   645 TAAIQGYKLYYKEEGQQENGPIFLD---TKD---------LLYTLSGLDPRRKYHVRLLAYNNID 697

  Fly  1203 DG-----VVSKPLFCHSEED----VPEAPADIKVVSSSSQSLYISWLPPNEPNGVITKYSLYTRV 1258
            ||     .||.| .|.|..|    .|..|..:...:::|.|:::.|..|......|..|::....
Human   698 DGYQADQTVSTP-GCVSVRDRMVPPPPPPHHLYAKANTSSSIFLHWRRPAFTAAQIINYTIRCNP 761

  Fly  1259 VNGREELNNEK--RSLPSQQAYYEAKGLHPHMEYQFWVTASTRVGEGKSSRVSSQITTNRIPARI 1321
            |.    |.|..  ..|.:.:.:...:||.|:.:|:|.|....       .::||           
Human   762 VG----LQNASLVLYLQTSETHMLVQGLEPNTKYEFAVRLHV-------DQLSS----------- 804

  Fly  1322 ISFGGPVVRPWRSTVTLPCTAVGKPKREWFKSDVALRQGGLHNSQLLDSGDLIISSLQLADGGNY 1386
                     ||...|                                                  
Human   805 ---------PWSPVV-------------------------------------------------- 810

  Fly  1387 SCQVDNGIGTDRLTHTLIVQVPPTAPV-LYVTSATSSSILMHWKCGFTGNAPITGYTLFY--RRA 1448
                         .|:.:.:.|...|| :.||.....:.|:.||........:|.||:.|  |:|
Human   811 -------------YHSTLPEAPAGPPVGVKVTLIEDDTALVSWKPPDGPETVVTRYTILYASRKA 862

  Fly  1449 --NGNTDEMQLSRHASSHELKGLMCGSTYQIHLSAQNKVGTSPTS 1491
              .|....:......:...|:.|:.|:.|.:.:||.|:||..|.|
Human   863 WIAGEWQVLHREGAITMALLENLVAGNVYIVKISASNEVGEGPFS 907

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 30..128 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand E 86..90 CDD:409353
Ig strand F 106..111 CDD:409353
Ig strand G 119..123 CDD:409353
V-set 138..229 CDD:462230
Ig 238..327 CDD:472250
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 293..297 CDD:409353
Ig strand F 307..312 CDD:409353
Ig strand G 320..323 CDD:409353
Ig 330..418 CDD:472250
Ig strand B 348..352 CDD:409353
Ig strand C 365..369 CDD:409353
Ig strand E 383..387 CDD:409353
Ig strand F 397..402 CDD:409353
Ig strand G 411..414 CDD:409353
IgI_4_Dscam 422..517 CDD:409548
Ig strand A 422..425 CDD:409548
Ig strand A' 431..435 CDD:409548
Ig strand B 438..447 CDD:409548
Ig strand C 452..458 CDD:409548
Ig strand C' 460..463 CDD:409548
Ig strand D 468..476 CDD:409548
Ig strand E 480..489 CDD:409548
Ig strand F 496..504 CDD:409548
Ig strand G 507..517 CDD:409548
IgI_5_Dscam 521..608 CDD:409550 25/92 (27%)
Ig strand A 521..523 CDD:409550 0/1 (0%)
Ig strand A' 528..532 CDD:409550 2/3 (67%)
Ig strand B 535..542 CDD:409550 1/6 (17%)
Ig strand C 549..555 CDD:409550 1/5 (20%)
Ig strand C' 556..558 CDD:409550 0/1 (0%)
Ig strand D 565..569 CDD:409550 1/3 (33%)
Ig strand E 572..578 CDD:409550 4/5 (80%)
Ig strand F 586..594 CDD:409550 4/7 (57%)
Ig strand G 598..608 CDD:409550 1/11 (9%)
Ig 611..704 CDD:472250 18/93 (19%)
Ig strand B 630..634 CDD:409353 1/3 (33%)
Ig strand C 644..648 CDD:409353 1/3 (33%)
Ig strand E 670..674 CDD:409353 1/3 (33%)
Ig strand F 684..689 CDD:409353 3/4 (75%)
Ig strand G 697..700 CDD:409353 0/2 (0%)
IgI_7_Dscam 707..802 CDD:409546 25/104 (24%)
Ig strand A 707..711 CDD:409546 2/12 (17%)
Ig strand A' 716..720 CDD:409546 0/3 (0%)
Ig strand B 723..732 CDD:409546 2/8 (25%)
Ig strand C 738..744 CDD:409546 2/5 (40%)
Ig strand C' 750..753 CDD:409546 0/2 (0%)
Ig strand D 761..764 CDD:409546 1/2 (50%)
Ig strand E 767..773 CDD:409546 2/5 (40%)
Ig strand F 780..788 CDD:409546 4/7 (57%)
Ig strand G 793..802 CDD:409546 1/8 (13%)
Ig 806..892 CDD:472250 18/85 (21%)
Ig strand B 823..827 CDD:409353 1/3 (33%)
Ig strand C 836..840 CDD:409353 0/3 (0%)
Ig strand E 868..872 CDD:409353 1/3 (33%)
Ig strand F 882..887 CDD:409353 2/4 (50%)
FN3 <904..1195 CDD:442628 81/302 (27%)
FN3 906..1006 CDD:238020 24/99 (24%)
fn3 1221..1306 CDD:394996 17/86 (20%)
Ig 1336..1396 CDD:409353 1/59 (2%)
Ig strand B 1336..1340 CDD:409353 1/3 (33%)
Ig strand E 1371..1375 CDD:409353 0/3 (0%)
Ig strand F 1385..1390 CDD:409353 0/4 (0%)
FN3 <1407..>1606 CDD:442628 26/90 (29%)
fn3 1408..1491 CDD:394996 25/87 (29%)
PRTGNP_776175.2 Ig 38..130 CDD:472250 26/90 (29%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 0/3 (0%)
Ig strand E 91..95 CDD:409353 3/3 (100%)
Ig strand F 110..115 CDD:409353 2/4 (50%)
Ig strand G 124..127 CDD:409353 1/2 (50%)
IG_like 141..223 CDD:214653 19/89 (21%)
Ig strand B 152..156 CDD:409353 1/3 (33%)
Ig strand C 165..169 CDD:409353 1/3 (33%)
Ig strand E 188..192 CDD:409353 1/3 (33%)
Ig strand F 202..207 CDD:409353 3/4 (75%)
Ig_3 235..307 CDD:464046 21/78 (27%)
I-set 327..412 CDD:400151 20/95 (21%)
Ig strand B 345..348 CDD:143205 0/2 (0%)
Ig strand C 357..361 CDD:143205 0/3 (0%)
Ig strand E 378..382 CDD:143205 1/3 (33%)
Ig strand F 392..397 CDD:143205 2/4 (50%)
Ig strand G 405..408 CDD:143205 0/2 (0%)
FN3 419..512 CDD:238020 24/99 (24%)
FN3 517..610 CDD:238020 35/101 (35%)
fn3 624..699 CDD:394996 21/88 (24%)
FN3 <728..>936 CDD:442628 48/274 (18%)
FN3 821..911 CDD:238020 25/87 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 981..1002
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1086..1150
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.