DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and dpr7

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:337 Identity:69/337 - (20%)
Similarity:118/337 - (35%) Gaps:89/337 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   611 PPKLSPFQTNILQLNMGDRASLTCSVVKGDLPLTINWRKD-GRP-IDPTQHMSVKQVDQYNSILV 673
            |.|:.||...:|.||      :.|..:.....|::|...: .|| .|.....:|..|....:|| 
  Fly    14 PIKIKPFIILVLNLN------IWCQYISATSYLSLNDLTNLERPFFDDISPRNVSAVVDEIAIL- 71

  Fly   674 IENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWIVEPVDANVERNRHIMLHCQAQGVPTPS 738
                        .|.|:|..           |....|:       .:|:.||:         |.:
  Fly    72 ------------RCRVKNKG-----------NRTVSWM-------RKRDLHIL---------TTN 97

  Fly   739 IVWKKATGSKSGEYEEVRERPFTKLLGNGS----LLLQHVKEDREGFYLCQANNGIGTGIGKVIQ 799
            |            |....::.|:.:...||    |.:.:.:....|.|.||.|......:...:|
  Fly    98 I------------YTYTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQ 150

  Fly   800 ---------LKVNSSPYFSSTSRS-------VMVKKGDTALLQCAVSGDKPINIVWMRSGKNTLN 848
                     ||.....|.:.::|:       :.||:..|..|.|:|:...| :::|.........
  Fly   151 VIADNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTIALACSVNIHAP-SVIWYHGSSVVDF 214

  Fly   849 PSTNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLE 913
            .|....||::.|.|..|.::.|.:......|||.|.|..:.......::..|..::|        
  Fly   215 DSLRGGISLETEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVLTGEQP-------- 271

  Fly   914 AAMISSRSVNIK 925
            |||.:|.::.|:
  Fly   272 AAMQTSSAIRIR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653
IGc2 436..507 CDD:197706
I-set 521..610 CDD:254352
IGc2 533..597 CDD:197706
Ig 630..699 CDD:143165 13/70 (19%)
IG_like 714..802 CDD:214653 17/100 (17%)
Ig 725..802 CDD:299845 15/89 (17%)
Ig 823..894 CDD:143165 17/70 (24%)
FN3 906..1006 CDD:238020 5/20 (25%)
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
dpr7NP_001096850.2 V-set 56..145 CDD:284989 24/140 (17%)
IG_like 58..140 CDD:214653 24/133 (18%)
IG_like 179..265 CDD:214653 20/86 (23%)
Ig 187..257 CDD:299845 18/70 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.