DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and CNTN6

DIOPT Version :10

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_055276.1 Gene:CNTN6 / 27255 HGNCID:2176 Length:1028 Species:Homo sapiens


Alignment Length:1199 Identity:286/1199 - (23%)
Similarity:458/1199 - (38%) Gaps:278/1199 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 RLTRQVVVSSPTRLRINSHR--GIISPSVVEHTAH-----VQVSQDEGAVLLCVAQGCPSPEYSW 271
            ||..::|:..|.   |||..  |::|..:.....|     :.:|:.| .:|.|.|.|.|||.|.|
Human     2 RLLWKLVILLPL---INSSAGDGLLSRPIFTQEPHDVIFPLDLSKSE-VILNCAANGYPSPHYRW 62

  Fly   272 FTHNGAGPLPVLSGPRVRLLGPILAIEAV-TGEDSGVYKCTAGNVGG---EASAELRLTVATPIQ 332
             ..||. .:........||.|..|||.:. |.:|.|:|:|.|.|:.|   ...|:|:.......:
Human    63 -KQNGT-DIDFTMSYHYRLDGGSLAINSPHTDQDIGMYQCLATNLLGTILSRKAKLQFAYIEDFE 125

  Fly   333 VEISPNVLSVHMGGTAEFRC-----------LVTSNGSPVGMQNILWYKDGRQLPSSGRVEDT-- 384
            .: :.:.:||..|......|           ..|.|.:|:.:|     :|.|:..|    ::|  
Human   126 TK-TRSTVSVREGQGVVLLCGPPPHFGDLSYAWTFNDNPLYVQ-----EDNRRFVS----QETGN 180

  Fly   385 LVVPRVSRENRGMYQCV---------VRRPEGDTFQATAELQLGDAPPVLLYSFIEQTLQPG--P 438
            |.:.:|...:.|.|.|.         |:.|.....|.|..: :|:..|.:...|.| |:|..  .
Human   181 LYIAKVEPSDVGNYTCFITNKEAQRSVQGPPTPLVQRTDGV-MGEYEPKIEVRFPE-TIQAAKDS 243

  Fly   439 AVSLKCSAAGNPTPQISW-TLDGFPLPSNGRFMIGQYITVHGDVISHVNISHVMVEDGGEYACIA 502
            :|.|:|.|.|||.|.||| .|||.|||...::...|.|         :.|.:...||.|.|.|||
Human   244 SVKLECFALGNPVPDISWRRLDGSPLPGKVKYSKSQAI---------LEIPNFQQEDEGFYECIA 299

  Fly   503 ENRAGRVQHAARLNIYGLPYIRLIPKVTAVSGETLNLKCPVAGYPIEEIHWERGGRELPDDIRQR 567
            .|..||.....:|..|..|                              .||           |:
Human   300 SNLRGRNLAKGQLIFYAPP------------------------------EWE-----------QK 323

  Fly   568 VQPDGSLTISPVQKNSDSGVY--TCWARNKQGHSARRSGEVTVIVPPKLSPFQTNILQLNMGDRA 630
            :|            |:...:|  ..|       ..:.||        |.:|:.|           
Human   324 IQ------------NTHLSIYDNLLW-------ECKASG--------KPNPWYT----------- 350

  Fly   631 SLTCSVVKGDLPLTINWRKDGRPIDPTQHMSVKQVDQYNSILVIENLGSDHTGNYSCVVRNSAAE 695
                            |.|:|..::|.:.:.::     |..|:|..|....:|.|.|...|....
Human   351 ----------------WLKNGERLNPEERIQIE-----NGTLIITMLNVSDSGVYQCAAENKYQI 394

  Fly   696 V-ENSQALLVNVPPRWIVEPVDAN--VERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRE 757
            : .|::..::...|.:...||...  |:....|::.|:....|..:|.||:.|       |.:|:
Human   395 IYANAELRVLASAPDFSKSPVKKKSFVQVGGDIVIGCKPNAFPRAAISWKRGT-------ETLRQ 452

  Fly   758 RPFTKLLGNGSLLLQHVKEDREGFYLCQANNGIGT--GIGKVIQLKVNSSPYFSSTSRSVMVKKG 820
            .....||.:|||.:.::.....|.|.|.|.|..||  ..|.:|   |......:.....:.|..|
Human   453 SKRIFLLEDGSLKIYNITRSDAGSYTCIATNQFGTAKNTGSLI---VKERTVITVPPSKMDVTVG 514

  Fly   821 DTALLQCAVSGDKPINI--VWMRSGKNTLNPSTNYKISVKQEATPDGVS----------AELQIR 873
            ::.:|.|.||.|..|.:  ||..:|.         .|.:|:     ||:          .:|.||
Human   515 ESIVLPCQVSHDPSIEVVFVWFFNGD---------VIDLKK-----GVAHFERIGGESVGDLMIR 565

  Fly   874 TVDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDVTK 938
            .:....||.|.|.......:...:..:.|:.||.||..::...|||.:..:.|:           
Human   566 NIQLHHSGKYLCTVQTTLESLSAVADIIVRGPPGPPEDVQVEDISSTTSQLSWR----------- 619

  Fly   939 YIVEFREADHSLPPALFVDQ--------WQQI----EVKDPPHFNAMIENLKPATRYAFRVIAEG 991
                 ...|::.|..:|..|        ||.:    |:.:...:||.:..|.|...|.|||:|..
Human   620 -----AGPDNNSPIQIFTIQTRTPFSVGWQAVATVPEILNGKTYNATVVGLSPWVEYEFRVVAGN 679

  Fly   992 SAGRSAPSQ--ELIVRTEPQRPAGPPLSLSARPLSSTELLISWVAPLPELRHGDIQGYNVGYKLS 1054
            |.|...||:  ||: ||:...|...|:::.....|.:||:|:|.:...||::|:..||.:.::  
Human   680 SIGIGEPSEPSELL-RTKASVPVVAPVNIHGGGGSRSELVITWESIPEELQNGEGFGYIIMFR-- 741

  Fly  1055 SSGNTAYNFTSVSGDGDGGNGELLLSGLAKFARYTVVVQAFNQVGPGPLSEPTAAQTMEDVPSRP 1119
            ..|:|.::...|| ..:..........:...:.:.|.|..:|..|.|.||..|...:.||.|...
Human   742 PVGSTTWSKEKVS-SVESSRFVYRNESIIPLSPFEVKVGVYNNEGEGSLSTVTIVYSGEDEPQLA 805

  Fly  1120 PEDVRCAALSSQSLQVSWQPPPIYHTNGLLQGYKLIFEPIIDDIQPS---KDEVESRKTTALTMV 1181
            |......:.|:..::|||.........|.:.||::::  ..||.:.|   |..|....|   |..
Human   806 PRGTSLQSFSASEMEVSWNAIAWNRNTGRVLGYEVLY--WTDDSKESMIGKIRVSGNVT---TKN 865

  Fly  1182 LTGLRKYTNYSIQVLAHTRMGDGVVSKPLFCHSEEDVP-EAPADI--KVVSSSSQSLYISW--LP 1241
            :|||:..|.|...|.|:...|.|..|.|:...:::..| :.||:|  |:.:|   .|.::|  :.
Human   866 ITGLKANTIYFASVRAYNTAGTGPSSPPVNVTTKKSPPSQPPANIAWKLTNS---KLCLNWEHVK 927

  Fly  1242 PNEPNGVITKYSLYTRVVNGRE------ELNNEKRSL--PSQQAYYEAKGLHPHMEYQFWVTAST 1298
            ..|....:..|.:..|  ..|:      |.||....|  |.::            :|...:...:
Human   928 TMENESEVLGYKILYR--QNRQSKTHILETNNTSAELLVPFEE------------DYLIEIRTVS 978

  Fly  1299 RVGEGKSSRVSSQITTNRIPARIISFGGP 1327
            ..|:|.||........:.:.:|.|.|..|
Human   979 DGGDGSSSEEIRIPKMSSLSSRGIQFLEP 1007

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 30..128 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand E 86..90 CDD:409353
Ig strand F 106..111 CDD:409353
Ig strand G 119..123 CDD:409353
V-set 138..229 CDD:462230 4/14 (29%)
Ig 238..327 CDD:472250 30/97 (31%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 1/3 (33%)
Ig strand E 293..297 CDD:409353 1/3 (33%)
Ig strand F 307..312 CDD:409353 2/4 (50%)
Ig strand G 320..323 CDD:409353 1/2 (50%)
Ig 330..418 CDD:472250 21/109 (19%)
Ig strand B 348..352 CDD:409353 0/3 (0%)
Ig strand C 365..369 CDD:409353 0/3 (0%)
Ig strand E 383..387 CDD:409353 2/5 (40%)
Ig strand F 397..402 CDD:409353 2/13 (15%)
Ig strand G 411..414 CDD:409353 1/2 (50%)
IgI_4_Dscam 422..517 CDD:409548 36/97 (37%)
Ig strand A 422..425 CDD:409548 1/2 (50%)
Ig strand A' 431..435 CDD:409548 2/3 (67%)
Ig strand B 438..447 CDD:409548 3/8 (38%)
Ig strand C 452..458 CDD:409548 4/6 (67%)
Ig strand C' 460..463 CDD:409548 1/2 (50%)
Ig strand D 468..476 CDD:409548 1/7 (14%)
Ig strand E 480..489 CDD:409548 1/8 (13%)
Ig strand F 496..504 CDD:409548 5/7 (71%)
Ig strand G 507..517 CDD:409548 3/9 (33%)
IgI_5_Dscam 521..608 CDD:409550 10/88 (11%)
Ig strand A 521..523 CDD:409550 1/1 (100%)
Ig strand A' 528..532 CDD:409550 0/3 (0%)
Ig strand B 535..542 CDD:409550 0/6 (0%)
Ig strand C 549..555 CDD:409550 1/5 (20%)
Ig strand C' 556..558 CDD:409550 0/1 (0%)
Ig strand D 565..569 CDD:409550 1/3 (33%)
Ig strand E 572..578 CDD:409550 0/5 (0%)
Ig strand F 586..594 CDD:409550 2/9 (22%)
Ig strand G 598..608 CDD:409550 2/9 (22%)
Ig 611..704 CDD:472250 16/93 (17%)
Ig strand B 630..634 CDD:409353 0/3 (0%)
Ig strand C 644..648 CDD:409353 0/3 (0%)
Ig strand E 670..674 CDD:409353 1/3 (33%)
Ig strand F 684..689 CDD:409353 2/4 (50%)
Ig strand G 697..700 CDD:409353 1/2 (50%)
IgI_7_Dscam 707..802 CDD:409546 27/98 (28%)
Ig strand A 707..711 CDD:409546 1/3 (33%)
Ig strand A' 716..720 CDD:409546 0/5 (0%)
Ig strand B 723..732 CDD:409546 2/8 (25%)
Ig strand C 738..744 CDD:409546 3/5 (60%)
Ig strand C' 750..753 CDD:409546 0/2 (0%)
Ig strand D 761..764 CDD:409546 0/2 (0%)
Ig strand E 767..773 CDD:409546 3/5 (60%)
Ig strand F 780..788 CDD:409546 4/7 (57%)
Ig strand G 793..802 CDD:409546 2/8 (25%)
Ig 806..892 CDD:472250 22/97 (23%)
Ig strand B 823..827 CDD:409353 1/3 (33%)
Ig strand C 836..840 CDD:409353 1/5 (20%)
Ig strand E 868..872 CDD:409353 1/3 (33%)
Ig strand F 882..887 CDD:409353 2/4 (50%)
FN3 <904..1195 CDD:442628 79/307 (26%)
FN3 906..1006 CDD:238020 29/113 (26%)
fn3 1221..1306 CDD:394996 19/96 (20%)
Ig 1336..1396 CDD:409353
Ig strand B 1336..1340 CDD:409353
Ig strand E 1371..1375 CDD:409353
Ig strand F 1385..1390 CDD:409353
FN3 <1407..>1606 CDD:442628
fn3 1408..1491 CDD:394996
CNTN6NP_055276.1 Ig 26..120 CDD:472250 30/96 (31%)
Ig strand B 46..50 CDD:409353 1/3 (33%)
Ig strand C 59..63 CDD:409353 2/4 (50%)
Ig strand E 82..86 CDD:409353 1/3 (33%)
Ig strand F 97..102 CDD:409353 2/4 (50%)
Ig strand G 111..114 CDD:409353 0/2 (0%)
Ig 129..214 CDD:472250 19/93 (20%)
Ig strand B 140..144 CDD:409353 0/3 (0%)
Ig strand C 154..158 CDD:409353 0/3 (0%)
Ig strand E 179..183 CDD:409353 1/3 (33%)
Ig strand F 193..198 CDD:409353 2/4 (50%)
Ig strand G 209..212 CDD:409353 1/2 (50%)
Ig 227..315 CDD:472250 36/97 (37%)
Ig strand B 245..249 CDD:409353 2/3 (67%)
Ig strand C 258..262 CDD:409353 2/3 (67%)
Ig strand E 280..284 CDD:409353 1/12 (8%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
Ig strand G 307..310 CDD:409353 0/2 (0%)
Ig 319..403 CDD:472250 25/153 (16%)
Ig strand B 335..339 CDD:409353 1/10 (10%)
Ig strand C 348..352 CDD:409353 1/30 (3%)
Ig strand E 369..373 CDD:409353 1/3 (33%)
Ig strand F 383..388 CDD:409353 2/4 (50%)
Ig strand G 396..399 CDD:409353 0/2 (0%)
Ig5_Contactin 408..496 CDD:409358 27/97 (28%)
Ig strand A 408..413 CDD:409358 1/4 (25%)
Ig strand A' 416..421 CDD:409358 0/4 (0%)
Ig strand B 425..432 CDD:409358 1/6 (17%)
Ig strand C 440..444 CDD:409358 1/3 (33%)
Ig strand D 458..461 CDD:409358 2/2 (100%)
Ig strand E 462..467 CDD:409358 3/4 (75%)
Ig strand F 475..483 CDD:409358 4/7 (57%)
Ig strand G 489..496 CDD:409358 2/9 (22%)
Ig 500..598 CDD:472250 23/111 (21%)
Ig strand B 517..521 CDD:409353 1/3 (33%)
Ig strand C 532..536 CDD:409353 1/3 (33%)
Ig strand E 560..564 CDD:409353 1/3 (33%)
FN3 573..>916 CDD:442628 94/367 (26%)
Ig strand F 574..579 CDD:409353 2/4 (50%)
Ig strand G 587..590 CDD:409353 0/2 (0%)
FN3 598..691 CDD:238020 27/108 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 887..908 4/20 (20%)
FN3 906..991 CDD:238020 21/101 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.