Sequence 1: | NP_001261500.1 | Gene: | Dscam2 / 38788 | FlyBaseID: | FBgn0265296 | Length: | 2101 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_056428.1 | Gene: | LRIT1 / 26103 | HGNCID: | 23404 | Length: | 623 | Species: | Homo sapiens |
Alignment Length: | 243 | Identity: | 62/243 - (25%) |
---|---|---|---|
Similarity: | 92/243 - (37%) | Gaps: | 42/243 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 798 IQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGDKPINIVWMRSGKNTLNPSTNYKISVKQEAT 862
Fly 863 PDGVS-AELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIKW 926
Fly 927 QPKTLGTGDVTKYIVEF--READHSLPPALFVDQWQQIEVKDPPHFNAMIENLKPATRYAFRVIA 989
Fly 990 EGSAGRSAPSQELIVRTEPQRPAGPPLSLSARPLSSTELLIS--WVAP 1035 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dscam2 | NP_001261500.1 | Ig | 51..127 | CDD:299845 | |
Ig | 138..>203 | CDD:299845 | |||
I-set | 238..327 | CDD:254352 | |||
Ig | 247..327 | CDD:299845 | |||
I-set | 332..418 | CDD:254352 | |||
IGc2 | 344..407 | CDD:197706 | |||
IG_like | 432..517 | CDD:214653 | |||
IGc2 | 436..507 | CDD:197706 | |||
I-set | 521..610 | CDD:254352 | |||
IGc2 | 533..597 | CDD:197706 | |||
Ig | 630..699 | CDD:143165 | |||
IG_like | 714..802 | CDD:214653 | 1/3 (33%) | ||
Ig | 725..802 | CDD:299845 | 1/3 (33%) | ||
Ig | 823..894 | CDD:143165 | 25/71 (35%) | ||
FN3 | 906..1006 | CDD:238020 | 21/101 (21%) | ||
FN3 | 1013..1111 | CDD:238020 | 6/25 (24%) | ||
FN3 | 1119..1209 | CDD:238020 | |||
FN3 | 1219..1313 | CDD:238020 | |||
Ig | 1336..1402 | CDD:143165 | |||
FN3 | 1409..1498 | CDD:238020 | |||
FN3 | 1515..1588 | CDD:238020 | |||
LRIT1 | NP_056428.1 | LRR 1 | 60..81 | ||
leucine-rich repeat | 61..84 | CDD:275378 | |||
LRR_8 | 63..143 | CDD:290566 | |||
LRR 2 | 84..105 | ||||
leucine-rich repeat | 85..132 | CDD:275378 | |||
LRR 3 | 108..129 | ||||
LRR_8 | 131..202 | CDD:290566 | |||
LRR_4 | 131..171 | CDD:289563 | |||
LRR 4 | 132..153 | ||||
leucine-rich repeat | 133..156 | CDD:275378 | |||
LRR 5 | 156..177 | ||||
leucine-rich repeat | 157..180 | CDD:275378 | |||
leucine-rich repeat | 181..205 | CDD:275378 | |||
TPKR_C2 | 201..>240 | CDD:301599 | |||
Ig | 267..345 | CDD:299845 | 28/83 (34%) | ||
IG_like | 267..345 | CDD:214653 | 28/83 (34%) | ||
FN3 | 431..498 | CDD:214495 | 8/34 (24%) | ||
LRR 6. /evidence=ECO:0000305 | 571..594 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |