DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and HMCN2

DIOPT Version :10

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_001278744.1 Gene:HMCN2 / 256158 HGNCID:21293 Length:5079 Species:Homo sapiens


Alignment Length:2436 Identity:537/2436 - (22%)
Similarity:831/2436 - (34%) Gaps:641/2436 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LDCSASGSPQPTVDWVHADGSAVTEIHGVRRVLRNGTLVLMPFAAAAYHQDV-HNTIYRCIASNS 114
            |.|.|||||.||:.|:. :|....|:.|| :|...||.:.:.      |.:: |:.::.|.|:|.
Human  1739 LPCQASGSPVPTIQWLQ-NGRPAEELAGV-QVASQGTTLHID------HVELDHSGLFACQATNE 1795

  Fly   115 VGRIVSRDVQVRAVVAQAYKVDV---EVLSAARGCTAILRCV---VPTFVKELVRVVSWVHEPAI 173
            .|   :...:|...|.:...|.:   |.::|.......|:|:   |||                 
Human  1796 AG---TAGAEVEVSV
HEFPSVSIIGGENITAPFLQPVTLQCIGDGVPT----------------- 1840

  Fly   174 YIYPSLQ--GDGKFHLLPTGELLIHNLQESDESQSFRCRSMHRLTRQVVVSSPTRLRINSHRGI- 235
               |||:  .||.......|.|.|..:...||.              :...:.|.|...|.|.: 
Human  1841 ---PSLRWWKDGVALAAFGGNLQIEKVDLRDEG--------------IYTCAATNLAGESKREVA 1888

  Fly   236 ----ISPSVVEHTAHVQVSQDEGAVLLCVAQGCPSPEYSWFTHNGAGPLPVLSGPRVRLLGPILA 296
                :.|::.....:..|.::....|.|:|.|.|.|:.|||  .|..|:....|..|.:.|.:|.
Human  1889 LKVLVPPNIEPGPVNKAVLENASVTLECLASGVPPPDVSWF--KGHQPVSSWMGVTVSVDGRVLR 1951

  Fly   297 IEAVTGEDSGVYKCTAGNVGGEASAELR--LTVATPIQVEISPNVLS-VHMGGTAEFRCLVTSNG 358
            ||.....|:|.|:|.|.||.|  |.|||  |.|..|.::.:.|::.. |.:.......|..|...
Human  1952 IEQAQLSDAGSYRCVASNVAG--STELRYGLRVNVPPRITLPPSLPGPVLVNTPVRLTCNATGAP 2014

  Fly   359 SPVGMQNILWYKDGR----------QLPSSGRVEDTLVVPRVSRENRGMYQCVVRRPEGDTFQAT 413
            ||    .::|.|||.          |:...|||. ||...|.|  :.|.|.||.....|:..|..
Human  2015 SP----TLMWLKDGNPVSPAGTPGLQVFPGGRVL-TLASARAS--DSGRYSCVAVSAVGEDRQDV 2072

  Fly   414 AELQLGDAPPVLLYSFIEQTLQPGPAVSLKCSAAGNPTPQISWTLDGFPL-PSNGRFMIGQYITV 477
            . ||: ..||.:|...:..::....:|:|:|.:...|.|.:||..||.|| |..|       :.:
Human  2073 V-LQV-HMPPSILGEELNVSVVANESVALECQSHAMPPPVLSWWKDGRPLEPRPG-------VHL 2128

  Fly   478 HGDVISHVNISHVMVEDGGEYACIAENRAGRVQHAARLNIYGLPY--IRLIPKVTAVSGETLNLK 540
            ..|. :.:.:....|.|.|.|.|.|.|:||..:....||::..|.  :|....:|...|....|.
Human  2129 SADK-ALLQVDRADVWDAGHYTCEALNQAGHSEKHYNLNVWVAPVFPLRESHTLTVREGHPTRLS 2192

  Fly   541 CPVAGYPIEEIHWERGGRELPDDIR--QRVQPDGSLTISPVQKNSDSGVYTCWARNKQGHSARRS 603
            |...|.|..:|.|.:.|:.||.:..  |.|...|.|......:.:..|.|||...|..|:|: :.
Human  2193 CECRGVPFPKISWRKDGQPLPGEGAGLQHVSAVGRLLYLGQAQLAQEGTYTCECSNVVGNSS-QD 2256

  Fly   604 GEVTVIVPPKLS-----PFQTNILQLNMGDRASLTCSVVKGDLPLTINWRKDGRPIDPTQHMSVK 663
            .::.|.|||:::     |.|.:::|..:   |:|.|:.. |..|.|:.|.:||:|:.....:   
Human  2257 LQLEVHVPPQIAGPREPPTQVSVVQDGV---ATLECNAT-GKPPPTVTWERDGQPVGAELGL--- 2314

  Fly   664 QVDQYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWI--VEPVDANVERNRH-- 724
            |:......|.:|...:.|||.||||..|.|...|....|.|.|||..|  ::|: .|:....|  
Human  2315 QLQNQGQSLHVERAQAAHTGRYSCVAENLAGRAERKFELSVLVPPELIGDLDPL-TNITAALHSP 2378

  Fly   725 IMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLGNGSLL-LQHVKEDREGFYLCQANN 788
            :.|.|:|.|:|.|:|.|.:      || |.|.....|.||..|.:| :...:|...|.|.|.|:|
Human  2379 LTLLCEAMGIPPPAIRWFR------GE-EPVSPGEDTYLLAGGWMLKMTQTQEQDSGLYSCLASN 2436

  Fly   789 GIGTGIGKVIQLKVNSSPYFSSTSRSVMVK--KGDTALLQCAVSGDKPINIVWMRSGKNTLNPST 851
            ..|.. .:...::|...|...:.....::|  .|.||.|.|.|:|.....:.|.:.|:.......
Human  2437 EAGEA-RRNFSVEVLVPPSIENEDLEEVIKVLDGQTAHLMCNVTGHPQPKLTWFKDGRPLARGDA 2500

  Fly   852 NYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLEAA- 915
            ::       .:||||.  ||:...:.:.:|.|.|.|:|..|...:..||.|.   |.|::|..| 
Human  2501 HH-------ISPDGVL--LQVLQANLSSAGHYSCIAANAVGEKTKHFQLSVL---LAPTILGGAE 2553

  Fly   916 --------------------MISSRSVNIKWQPKTLGTGDVTKYIVEFREADHSLPPALFVDQWQ 960
                                .::..|.||.|...  |........::.....|.|       |..
Human  2554 DSADEEVTVTVNNPISLICEALAFPSPNITWMKD--GAPFEASRNIQLLPGTHGL-------QIL 2609

  Fly   961 QIEVKDPPHFNAMIEN-LKPATR-YAFRVIAEGSAGRSAPSQELIVRTEPQRPAGPPLSLSARPL 1023
            ..:.:|...:..::.| |..|.: |...|:...|..:..|..|:.|: |.:......|:|...  
Human  2610 NAQKEDAGQYTCVVTNELGEAVKNYHVEVLIPPSISKDDPLAEVGVK-EVKTKVNSTLTLECE-- 2671

  Fly  1024 SSTELLISWVAPLPELR-HGDIQGYNVGYKL----------------SSSGNTAYNFTSVSGDGD 1071
                   ||..|.|.:| :.|.|......:|                |.||......|:|:|:.|
Human  2672 -------SWAVPPPTIRWYKDGQPVTPSSRLQVLGEGRLLQIQPTQVSDSGRYLCVATNVAGEDD 2729

  Fly  1072 GGNGELLLSGLAKFARYTVVVQA---FNQVGPGP-----LSEPTAAQ----TMEDVPSRPPEDVR 1124
                          ..:.|::|.   |.:||...     ||....|:    ...::....|..:.
Human  2730 --------------QDFNVLIQVPPMFQKVGDFSAAFEILSREEEARGGVTEYREIVENNPAYLY 2780

  Fly  1125 CAALSSQSLQVSW----QPPPIYHTNGLLQGYKLIFEPIIDDIQPSKDEVESRKTTALTMVLTGL 1185
            |...:.....::|    ||........:|||.:::..|::      :.|...|            
Human  2781 CDTNAIPPPDLTWYREDQPLSAGDEVSVLQGGRVLQIPLV------RAENAGR------------ 2827

  Fly  1186 RKYTNYSIQVLAHTRMGDG-------VVSKPLFCHSEEDVPEAPADIKVVSSSSQSLY------- 1236
                 ||.:  |...:|:.       |::.|:.....|::.|   ::.|.:||:.||.       
Human  2828 -----YSCK--ASNEVGEDWLHYELLVLTPPVILGDTEELVE---EVTVNASSTVSLQCPALGNP 2882

  Fly  1237 ---ISWLPPNEPNGVITKYSLYTRVVNGREELNNEKRSLPSQQAYYEAKGLHPHMEYQFWVTAST 1298
               ||||    .||:....|...:|:...:.|......:....:|                   .
Human  2883 VPTISWL----QNGLPFSPSPRLQVLEDGQVLQVSTAEVADAASY-------------------M 2924

  Fly  1299 RVGEGKSSRVSSQITTN-RIPARIISFG-GPVVRPWRSTVTLPCTAVGKPKRE--WFKSDVALRQ 1359
            .|.|.::.......|.. ::|.||.... ..|.....|:|:|||.....|..|  |:|...||..
Human  2925 CVAENQAGSAEKLFTLRVQVPPRIAGLDLEQVTAILNSSVSLPCDVHAHPNPEVTWYKDSQALSL 2989

  Fly  1360 G-------GLHNSQ-----LLDSG----------------------------------------- 1371
            |       |.|..|     |.|||                                         
Human  2990 GEEVFLLPGTHTLQLGRARLSDSGMYTCEALNAAGRDQKLVQLSVLVPPAFRQAPRGPQDAVLVR 3054

  Fly  1372 -----------------------------------------DLIISSLQLADGGNYSCQVDNGIG 1395
                                                     .|.|...|::|.|.|||:|.|..|
Human  3055 VGDKAVLSCETDALPEPTVTWYKDGQPLVLAQRTQALRGGQRLEIQEAQVSDKGLYSCKVSNVAG 3119

  Fly  1396 TDRLTHTLIVQVPPT--APVLYVTSATSSSILMHWKCGFTG-NAPITGYTLFYRRANGNTDEMQL 1457
            ....|.||.||||||  .|.....|..:.|.|: ..|..:| .||...:.         .|.|.:
Human  3120 EAVRTFTLTVQVPPTFENPKTETVSQVAGSPLV-LTCDVSGVPAPTVTWL---------KDRMPV 3174

  Fly  1458 SRHASSHELKGLMC-GSTYQIHLSAQNKVGTSPTSTILHVRTQGQSPGHPASTALLAPNSTSLLV 1521
                .|..:.|::. |...|:......:.|   |.|.:...||.::........|:||       
Human  3175 ----ESSAVHGVVSRGGRLQLSRLQPAQAG---TYTCVAENTQAEARKDFVVAVLVAP------- 3225

  Fly  1522 RLHSWPDNGCPLLYFVLQYRAVTDD--------PDAEWVL----VSNALKPQRR-------IVIN 1567
            |:.|   :|....:.||:.:.|..|        ||..|:.    :...:.|..|       :|:.
Human  3226 RIRS---SGVAREHHVLEGQEVRLDCEADGQPPPDVAWLKDGSPLGQDMGPHLRFYLDGGSLVLK 3287

  Fly  1568 NLQPSTLYQLRMEAHNVAG---------------ISQAEFNFVTLT------------------- 1598
            .|:.|........|||.||               |.|......||.                   
Human  3288 GLRASDAGAYTCVAHNPAGEDARLHTVNVLVPPTIKQGADGSGTLVSRPGELVTMVCPVRGSPPI 3352

  Fly  1599 -----KDGDPPP---PEIMHRGRSGQT----TVIFANINLLIPTIAAVSGM----FCTIIMI--- 1644
                 |||.|.|   ..::|  .||.|    .|..|:..:.....|:.:|:    |...:.:   
Human  3353 HVSWLKDGLPLPLSQRTLLH--GSGHTLRISKVQLADAGIFTCVAASPAGVADRNFTLQVQVPPV 3415

  Fly  1645 ---------IVCYRHML------------------KNAPPLAEQSQIQKESLENR---------- 1672
                     :|..|..|                  |:..||..||..|..||:..          
Human  3416 LEPVEFQNDVVVVRGSLVELPCEARGVPLPLVSWMKDGEPLLSQSLEQGPSLQLEAVGAGDSGTY 3480

  Fly  1673 ---ANSEAAQRERYYATIHKVSMQNNDKIPETSEDISPYATFQLSEAGGNMSQP----HHGGPAN 1730
               |.|||.:..|::...........|....|...::|.|..:|........||    |..|.|.
Human  3481 SCVAVSEAGEARRHFQLTVMEPPHIEDSGQPTELSLTPGAPMELLCDAQGTPQPNITWHKDGQAL 3545

  Fly  1731 TLLHSFMYHERAL-AEG----------CSSPPPAASKNRRRHSRKTEPESEESESDQDQLTSSR- 1783
            |.|.:.....|.| .|.          |.:..||.:..:....|...|.:         :...| 
Human  3546 TRLENNSRATRVLRVENVQVRDAGLYTCLAESPAGAIEKSFRVRVQAPPN---------IVGPRG 3601

  Fly  1784 -------------TESSNQHEGKIKHSIIYHGAQSSTSSDLSPMSEQKSLPRRGRSRYHHQQYQF 1835
                         .|.|.:.|...|  |.:|........|     .....|.|||   ..|....
Human  3602 PRFVVGLAPGQLVLECSVEAEPAPK--ITWHRDGIVLQED-----AHTQFPERGR---FLQLQAL 3656

  Fly  1836 STNTTPRHHNSNKMNNNTTS-----NTNTTATNTTATP--STSSNSNKILSPRGGNLKSISSTFK 1893
            ||..:..:..:.:....:||     ..:|..|..:..|  :.|.|...:|..:...:.:...:::
Human  3657 STADSGDYSCTARNAAGSTSVAFRVEIHTVPTIRSGPPAVNVSVNQTALLPCQADGVPAPLVSWR 3721

  Fly  1894 SQDSIQCHIPTLVKSPSISTQQQKQFHKQQLQNSSTNN-----SQHSSSNPNSSSLKQQQPLLIT 1953
            ..     .:|...:||......:.....|.:......:     |..:.|:.....|:..:|..|.
Human  3722 KD-----RVPLDPRSPRFEILPEGSLRIQPVLAQDAGHYLCLASNSAGSDRQGRDLRVLEPPAIA 3781

  Fly  1954 PKLHQ--LEANGQELLGLDGIGN-SPLVACMPPSSQ---------FRPIPHKSIMPAHEPPHH-- 2004
            |....  |.|:...||..:..|: .|||.......:         :|.:|..:::.....|..  
Human  3782 PSPSNLTLTAHTPALLPCEASGSPKPLVVWWKDGQKLDFRLQQGAYRLLPSNALLLTAPGPQDSA 3846

  Fly  2005 ------HNHSQQSH----------PHQQQQQQQHPGTLLNPSTAMLSSKFFTAPTL--PKXDTAN 2051
                  .|...::|          |.....|.....|::.|......|....|||:  .| ....
Human  3847 QFECVVSNEVGEAHRLYQVTVHVPPTIADDQTDFTVTMMAPVVLTCHSTGIPAPTVSWSKAGAQL 3911

  Fly  2052 G--GSEY---VGGAMEAMDGFGYDSGEISCT 2077
            |  ||.|   ..||:|........:|..:|:
Human  3912 GARGSGYRVSPSGALEIGQALPIHAGRYTCS 3942

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 30..128 CDD:472250 24/77 (31%)
Ig strand B 49..53 CDD:409353 1/1 (100%)
Ig strand C 62..66 CDD:409353 1/3 (33%)
Ig strand E 86..90 CDD:409353 2/3 (67%)
Ig strand F 106..111 CDD:409353 1/4 (25%)
Ig strand G 119..123 CDD:409353 0/3 (0%)
V-set 138..229 CDD:462230 19/95 (20%)
Ig 238..327 CDD:472250 32/90 (36%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 1/3 (33%)
Ig strand E 293..297 CDD:409353 1/3 (33%)
Ig strand F 307..312 CDD:409353 2/4 (50%)
Ig strand G 320..323 CDD:409353 1/2 (50%)
Ig 330..418 CDD:472250 26/98 (27%)
Ig strand B 348..352 CDD:409353 0/3 (0%)
Ig strand C 365..369 CDD:409353 0/3 (0%)
Ig strand E 383..387 CDD:409353 2/3 (67%)
Ig strand F 397..402 CDD:409353 2/4 (50%)
Ig strand G 411..414 CDD:409353 1/2 (50%)
IgI_4_Dscam 422..517 CDD:409548 27/95 (28%)
Ig strand A 422..425 CDD:409548 2/2 (100%)
Ig strand A' 431..435 CDD:409548 0/3 (0%)
Ig strand B 438..447 CDD:409548 3/8 (38%)
Ig strand C 452..458 CDD:409548 3/5 (60%)
Ig strand C' 460..463 CDD:409548 1/2 (50%)
Ig strand D 468..476 CDD:409548 0/7 (0%)
Ig strand E 480..489 CDD:409548 1/8 (13%)
Ig strand F 496..504 CDD:409548 4/7 (57%)
Ig strand G 507..517 CDD:409548 2/9 (22%)
IgI_5_Dscam 521..608 CDD:409550 24/90 (27%)
Ig strand A 521..523 CDD:409550 1/3 (33%)
Ig strand A' 528..532 CDD:409550 1/3 (33%)
Ig strand B 535..542 CDD:409550 1/6 (17%)
Ig strand C 549..555 CDD:409550 2/5 (40%)
Ig strand C' 556..558 CDD:409550 0/1 (0%)
Ig strand D 565..569 CDD:409550 1/5 (20%)
Ig strand E 572..578 CDD:409550 2/5 (40%)
Ig strand F 586..594 CDD:409550 4/7 (57%)
Ig strand G 598..608 CDD:409550 1/9 (11%)
Ig 611..704 CDD:472250 29/97 (30%)
Ig strand B 630..634 CDD:409353 2/3 (67%)
Ig strand C 644..648 CDD:409353 1/3 (33%)
Ig strand E 670..674 CDD:409353 1/3 (33%)
Ig strand F 684..689 CDD:409353 3/4 (75%)
Ig strand G 697..700 CDD:409353 1/2 (50%)
IgI_7_Dscam 707..802 CDD:409546 30/99 (30%)
Ig strand A 707..711 CDD:409546 2/3 (67%)
Ig strand A' 716..720 CDD:409546 1/3 (33%)
Ig strand B 723..732 CDD:409546 3/10 (30%)
Ig strand C 738..744 CDD:409546 2/5 (40%)
Ig strand C' 750..753 CDD:409546 2/2 (100%)
Ig strand D 761..764 CDD:409546 1/2 (50%)
Ig strand E 767..773 CDD:409546 2/6 (33%)
Ig strand F 780..788 CDD:409546 4/7 (57%)
Ig strand G 793..802 CDD:409546 0/8 (0%)
Ig 806..892 CDD:472250 22/87 (25%)
Ig strand B 823..827 CDD:409353 2/3 (67%)
Ig strand C 836..840 CDD:409353 0/3 (0%)
Ig strand E 868..872 CDD:409353 1/3 (33%)
Ig strand F 882..887 CDD:409353 2/4 (50%)
FN3 <904..1195 CDD:442628 61/346 (18%)
FN3 906..1006 CDD:238020 22/122 (18%)
fn3 1221..1306 CDD:394996 17/94 (18%)
Ig 1336..1396 CDD:409353 28/155 (18%)
Ig strand B 1336..1340 CDD:409353 2/3 (67%)
Ig strand E 1371..1375 CDD:409353 2/85 (2%)
Ig strand F 1385..1390 CDD:409353 3/4 (75%)
FN3 <1407..>1606 CDD:442628 55/263 (21%)
fn3 1408..1491 CDD:394996 18/86 (21%)
HMCN2NP_001278744.1 ChlD <3..207 CDD:440853
IG_like 434..513 CDD:214653
IG_like 524..604 CDD:214653
Ig strand B 534..538 CDD:409353
Ig strand C 547..551 CDD:409353
Ig strand E 570..574 CDD:409353
Ig strand F 584..589 CDD:409353
Ig strand G 597..600 CDD:409353
I-set 608..692 CDD:400151
Ig strand B 625..629 CDD:409353
Ig strand C 638..642 CDD:409353
Ig strand E 660..664 CDD:409353
Ig strand F 674..679 CDD:409353
Ig strand G 687..690 CDD:409353
IG_like 712..782 CDD:214653
Ig strand B 715..719 CDD:409353
Ig strand C 728..732 CDD:409353
Ig strand E 748..752 CDD:409353
Ig strand F 762..767 CDD:409353
IG_like 792..879 CDD:214653
Ig strand B 803..807 CDD:409353
Ig strand C 816..820 CDD:409353
Ig strand E 845..849 CDD:409353
Ig strand F 859..864 CDD:409353
Ig strand G 872..875 CDD:409353
I-set 885..972 CDD:400151
Ig strand B 902..906 CDD:409353
Ig strand C 916..920 CDD:409353
Ig strand F 952..957 CDD:409353
Ig strand G 965..968 CDD:409353
Ig_3 975..1050 CDD:464046
Ig 1080..1161 CDD:472250
Ig strand B 1091..1095 CDD:409353
Ig strand C 1104..1108 CDD:409353
Ig strand E 1127..1131 CDD:409353
Ig strand F 1141..1146 CDD:409353
Ig strand G 1154..1157 CDD:409353
Ig 1165..1246 CDD:472250
Ig strand B 1182..1186 CDD:409353
Ig strand C 1195..1199 CDD:409353
Ig strand E 1212..1216 CDD:409353
Ig strand F 1226..1231 CDD:409353
Ig strand G 1239..1242 CDD:409353
IG_like 1258..1340 CDD:214653
Ig strand B 1269..1273 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1271..1298
Ig strand C 1282..1286 CDD:409353
Ig strand E 1306..1310 CDD:409353
Ig strand F 1320..1325 CDD:409353
I-set 1354..1433 CDD:400151
Ig strand B 1363..1367 CDD:409353
Ig strand C 1376..1380 CDD:409353
Ig strand E 1399..1403 CDD:409353
Ig strand F 1413..1418 CDD:409353
Ig strand G 1426..1429 CDD:409353
IG_like 1446..1527 CDD:214653
Ig strand B 1456..1460 CDD:409353
Ig strand C 1469..1473 CDD:409353
Ig strand E 1492..1497 CDD:409353
Ig strand F 1507..1512 CDD:409353
I-set 1542..1620 CDD:400151
Ig strand B 1543..1554 CDD:409353
Ig strand C 1563..1567 CDD:409353
Ig strand E 1586..1590 CDD:409353
Ig strand F 1600..1605 CDD:409353
Ig 1632..1705 CDD:472250
Ig strand B 1644..1648 CDD:409353
Ig strand C 1657..1661 CDD:409353
Ig strand E 1680..1684 CDD:409353
Ig strand F 1694..1699 CDD:409353
I-set 1729..1807 CDD:400151 24/78 (31%)
Ig strand B 1737..1741 CDD:409353 1/1 (100%)
Ig strand C 1750..1754 CDD:409353 1/3 (33%)
Ig strand E 1772..1777 CDD:409353 2/4 (50%)
Ig strand F 1787..1792 CDD:409353 1/4 (25%)
Ig strand G 1800..1803 CDD:409353 0/2 (0%)
Ig 1820..1893 CDD:472250 20/106 (19%)
Ig strand B 1829..1833 CDD:409353 1/3 (33%)
Ig strand C 1842..1846 CDD:409353 2/3 (67%)
Ig strand E 1857..1861 CDD:409353 2/3 (67%)
Ig strand F 1871..1876 CDD:409353 0/4 (0%)
Ig strand G 1884..1887 CDD:409353 1/2 (50%)
I-set 1895..1975 CDD:400151 28/83 (34%)
Ig strand B 1912..1916 CDD:409353 1/3 (33%)
Ig strand C 1925..1929 CDD:409353 1/3 (33%)
Ig strand E 1948..1952 CDD:409353 1/3 (33%)
Ig strand F 1962..1967 CDD:409353 2/4 (50%)
Ig strand G 1975..1978 CDD:409353 2/2 (100%)
Ig_3 1985..2061 CDD:464046 22/82 (27%)
Ig_3 2079..2154 CDD:464046 23/82 (28%)
Ig 2171..2261 CDD:472250 24/90 (27%)
Ig strand B 2189..2193 CDD:409353 1/3 (33%)
Ig strand C 2202..2206 CDD:409353 1/3 (33%)
Ig strand E 2227..2231 CDD:409353 1/3 (33%)
Ig strand F 2241..2246 CDD:409353 3/4 (75%)
Ig strand G 2254..2257 CDD:409353 0/3 (0%)
I-set 2273..2355 CDD:400151 27/88 (31%)
Ig strand B 2285..2289 CDD:409353 2/3 (67%)
Ig strand C 2298..2302 CDD:409353 1/3 (33%)
Ig strand E 2320..2325 CDD:409353 1/4 (25%)
Ig strand F 2335..2340 CDD:409353 3/4 (75%)
Ig 2367..2449 CDD:472250 27/90 (30%)
Ig strand B 2379..2383 CDD:409353 1/3 (33%)
Ig strand C 2392..2396 CDD:409353 1/3 (33%)
Ig strand E 2415..2419 CDD:409353 1/3 (33%)
Ig strand F 2429..2434 CDD:409353 2/4 (50%)
Ig strand G 2442..2445 CDD:409353 0/2 (0%)
I-set 2464..2542 CDD:400151 24/86 (28%)
Ig strand B 2472..2476 CDD:409353 2/3 (67%)
Ig strand C 2485..2489 CDD:409353 0/3 (0%)
Ig strand E 2508..2512 CDD:409353 2/5 (40%)
Ig strand F 2522..2527 CDD:409353 2/4 (50%)
Ig strand G 2535..2538 CDD:409353 0/2 (0%)
I-set 2560..2638 CDD:400151 13/86 (15%)
Ig strand B 2568..2572 CDD:409353 0/3 (0%)
Ig strand C 2581..2585 CDD:409353 2/3 (67%)
Ig strand E 2604..2608 CDD:409353 2/10 (20%)
Ig strand F 2618..2623 CDD:409353 0/4 (0%)
I-set 2656..2728 CDD:400151 17/81 (21%)
Ig strand B 2666..2670 CDD:409353 2/3 (67%)
Ig strand C 2679..2683 CDD:409353 1/3 (33%)
Ig strand E 2702..2706 CDD:409353 0/3 (0%)
Ig strand F 2716..2721 CDD:409353 0/4 (0%)
Ig 2770..2847 CDD:472250 15/101 (15%)
Ig strand B 2777..2781 CDD:409353 0/3 (0%)
Ig strand C 2790..2794 CDD:409353 0/3 (0%)
Ig strand E 2814..2817 CDD:409353 0/2 (0%)
Ig strand F 2827..2832 CDD:409353 3/23 (13%)
Ig strand G 2840..2843 CDD:409353 0/2 (0%)
I-set 2864..2942 CDD:400151 18/100 (18%)
Ig strand B 2872..2876 CDD:409353 2/3 (67%)
Ig strand C 2885..2889 CDD:409353 2/3 (67%)
Ig strand E 2907..2912 CDD:409353 1/4 (25%)
Ig strand F 2922..2927 CDD:409353 1/23 (4%)
IG_like 2954..3034 CDD:214653 20/79 (25%)
Ig strand B 2964..2968 CDD:409353 2/3 (67%)
Ig strand C 2977..2981 CDD:409353 1/3 (33%)
Ig strand E 3000..3004 CDD:409353 1/3 (33%)
Ig strand F 3014..3019 CDD:409353 0/4 (0%)
I-set 3038..3129 CDD:400151 14/90 (16%)
Ig strand B 3059..3063 CDD:409353 0/3 (0%)
Ig strand C 3072..3076 CDD:409353 0/3 (0%)
Ig strand E 3095..3099 CDD:409353 1/3 (33%)
Ig strand F 3109..3114 CDD:409353 3/4 (75%)
Ig_3 3132..3208 CDD:464046 20/92 (22%)
I-set 3238..3308 CDD:400151 17/69 (25%)
Ig strand B 3244..3248 CDD:409353 1/3 (33%)
Ig strand C 3257..3261 CDD:409353 1/3 (33%)
Ig strand E 3282..3286 CDD:409353 0/3 (0%)
Ig strand F 3296..3301 CDD:409353 0/4 (0%)
I-set 3335..3410 CDD:400151 14/76 (18%)
Ig strand B 3340..3344 CDD:409353 0/3 (0%)
Ig strand C 3353..3357 CDD:409353 0/3 (0%)
Ig strand E 3376..3380 CDD:409353 1/3 (33%)
Ig strand F 3390..3395 CDD:409353 0/4 (0%)
Ig 3424..3499 CDD:472250 16/74 (22%)
Ig strand B 3433..3437 CDD:409353 0/3 (0%)
Ig strand C 3446..3450 CDD:409353 0/3 (0%)
Ig strand E 3464..3469 CDD:409353 2/4 (50%)
Ig strand F 3479..3484 CDD:409353 0/4 (0%)
Ig strand G 3492..3495 CDD:409353 1/2 (50%)
Ig 3503..3590 CDD:472250 18/86 (21%)
Ig strand B 3522..3526 CDD:409353 1/3 (33%)
Ig strand C 3535..3539 CDD:409353 0/3 (0%)
Ig strand E 3556..3560 CDD:409353 2/3 (67%)
Ig strand F 3570..3575 CDD:409353 1/4 (25%)
Ig strand G 3583..3586 CDD:409353 0/2 (0%)
Ig 3602..3683 CDD:472250 16/90 (18%)
Ig strand C 3626..3630 CDD:409353 2/5 (40%)
Ig strand E 3648..3653 CDD:409353 2/7 (29%)
Ig strand F 3663..3668 CDD:409353 0/4 (0%)
Ig 3689..3765 CDD:472250 9/80 (11%)
Ig strand B 3704..3708 CDD:409353 1/3 (33%)
Ig strand C 3717..3721 CDD:409353 0/3 (0%)
Ig strand E 3740..3744 CDD:409353 0/3 (0%)
Ig strand F 3754..3759 CDD:409353 0/4 (0%)
Ig_3 3777..3854 CDD:464046 14/76 (18%)
Ig 3873..3958 CDD:472250 17/70 (24%)
Ig strand B 3888..3892 CDD:409353 0/3 (0%)
Ig strand C 3901..3905 CDD:409353 1/3 (33%)
Ig strand E 3924..3928 CDD:409353 2/3 (67%)
Ig strand F 3938..3943 CDD:409353 1/5 (20%)
Ig strand G 3951..3954 CDD:409353
Ig_3 3962..4035 CDD:464046
I-set 4052..4139 CDD:400151
Ig strand B 4069..4073 CDD:409353
Ig strand C 4082..4086 CDD:409353
Ig strand E 4105..4109 CDD:409353
Ig strand F 4119..4124 CDD:409353
Ig strand G 4132..4135 CDD:409353
I-set 4143..4228 CDD:400151
Ig strand B 4160..4164 CDD:409353
Ig strand C 4173..4177 CDD:409353
Ig strand E 4194..4198 CDD:409353
Ig strand F 4208..4213 CDD:409353
Ig strand G 4223..4226 CDD:409353
I-set 4246..4317 CDD:400151
Ig strand B 4250..4254 CDD:409353
Ig strand C 4263..4267 CDD:409353
Ig strand E 4285..4289 CDD:409353
Ig strand F 4299..4304 CDD:409353
Ig 4324..4409 CDD:472250
Ig strand B 4340..4344 CDD:409353
Ig strand C 4353..4357 CDD:409353
Ig strand E 4375..4379 CDD:409353
Ig strand F 4389..4394 CDD:409353
Ig strand G 4402..4405 CDD:409353
nidG2 4411..4625 CDD:469646
FXa_inhibition 4652..4687 CDD:464251
EGF_CA 4689..4732 CDD:214542
EGF_CA 4733..4766 CDD:214542
EGF_CA 4776..4805 CDD:429571
EGF_CA 4883..4922 CDD:214542
EGF_CA 4923..4963 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.