DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and Lrit1

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_647547.2 Gene:Lrit1 / 246214 RGDID:628607 Length:623 Species:Rattus norvegicus


Alignment Length:500 Identity:99/500 - (19%)
Similarity:158/500 - (31%) Gaps:178/500 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   798 IQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGDKPINIVWMRSGKNTLNPSTNYKISVKQEAT 862
            ::|:...||.......|::...|.|.||:|..:|.....:.|.|:....||.      :|.||.:
  Rat   246 LELRKCQSPELRPGVTSIISPLGSTVLLRCGATGIPGPEMSWRRANGRPLNG------TVHQEVS 304

  Fly   863 PDGVS-AELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIKW 926
            .||.| ..|.:..|...|||.|.|:|.|..|..:.|:.|.|.||                     
  Rat   305 SDGSSWTLLDLPVVSLFDSGDYICQAKNFLGASETLISLIVTEP--------------------- 348

  Fly   927 QPKTLGTGDVTKYIVEFREADHSLPPALFVDQWQQIEVKDPPHFNAMIENLKPATRYAFRVIAEG 991
            |..|..||               :|.||    |.:                          ..||
  Rat   349 QTSTEYTG---------------IPGAL----WAR--------------------------TGEG 368

  Fly   992 SAGRSAPSQELIVRTEPQRPAGPPLSLSARPLSSTELLISWVAPLPELRHGDIQGYNVGYKLSSS 1056
             |..:|.:.:|:.|..|..|  .|::|:.:|            .:|.::.               
  Rat   369 -AEAAAYNNKLVARHVPHVP--EPVALATKP------------SVPSIKE--------------- 403

  Fly  1057 GNTAYNFTSVSGDGDGGNGELLLSGLAKFARYTVVVQAFNQVGPGPLS-EPTAAQTMEDVPSRPP 1120
                               ||.|             |.|....||..| ||:..|..:.|.|   
  Rat   404 -------------------ELPL-------------QNFQMDVPGEFSREPSEHQETQMVRS--- 433

  Fly  1121 EDVRCAALSSQSLQVSWQPPPIYHTNGLLQGYKLIFEPIIDDIQPSKDEVESRKTTALTMVLTGL 1185
              ::....:..|:.:.|:.|...:|.    .:.::: .:.......:..||:.||   ::.:.||
  Rat   434 --LKVVGDTYHSVSLVWKAPQAGNTT----AFSVLY-AVFGQRDMRRMTVEAGKT---SVTIEGL 488

  Fly  1186 RKYTNYSIQVLAHTRMGDGVVSKPLFC--HSEEDVPEAPADIKVVSSSSQSL-YISWLPPN---- 1243
            ...|.|...|...     |:|.....|  .|.::|.:|....::::....|: .|..|||.    
  Rat   489 APKTKYVACVCVR-----GLVPTKEQCVIFSTDEVVDAEGTQRLINMVVISVAAIIALPPTLLVC 548

  Fly  1244 -----------------EPNGVITKYSLYTRVVNGREELNNEKRS 1271
                             |.:|............:|.|||:....|
  Rat   549 CGALRRRCHKCRAGGSAEASGAYVNLERLGHSEDGSEELSRSSLS 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653
IGc2 436..507 CDD:197706
I-set 521..610 CDD:254352
IGc2 533..597 CDD:197706
Ig 630..699 CDD:143165
IG_like 714..802 CDD:214653 1/3 (33%)
Ig 725..802 CDD:299845 1/3 (33%)
Ig 823..894 CDD:143165 24/71 (34%)
FN3 906..1006 CDD:238020 13/99 (13%)
FN3 1013..1111 CDD:238020 14/98 (14%)
FN3 1119..1209 CDD:238020 15/89 (17%)
FN3 1219..1313 CDD:238020 12/74 (16%)
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Lrit1NP_647547.2 LRRNT 23..61 CDD:214470
LRR 1 60..81
LRR_8 63..143 CDD:290566
leucine-rich repeat 64..84 CDD:275378
LRR 2 84..105
leucine-rich repeat 85..132 CDD:275378
LRR 3 108..128
LRR_8 131..>176 CDD:290566
LRR_4 131..172 CDD:289563
LRR 4 132..153
leucine-rich repeat 133..156 CDD:275378
LRR 5 156..177
leucine-rich repeat 157..180 CDD:275378
leucine-rich repeat 181..205 CDD:275378
TPKR_C2 201..>240 CDD:301599
Ig 257..345 CDD:299845 29/93 (31%)
IG_like 267..345 CDD:214653 28/83 (34%)
FN3 431..501 CDD:214495 15/82 (18%)
LRR 6 525..548 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.