DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and Cntn2

DIOPT Version :10

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_796103.2 Gene:Cntn2 / 21367 MGIID:104518 Length:1040 Species:Mus musculus


Alignment Length:1297 Identity:303/1297 - (23%)
Similarity:459/1297 - (35%) Gaps:329/1297 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RFFVILLLLNLDNTCSEPFEAHLR------GPGFVMEPPGRV--EFSNSSGGWLDCSASGSPQPT 62
            |..::||||......|.|..:..:      ||.|..:|.|.:  |.|......|.|.|..||..|
Mouse     8 RASLLLLLLATMALVSSPGWSFSQGTPATFGPVFEEQPVGLLFPEESAEDQVTLACRARASPPAT 72

  Fly    63 VDWVHADGSAVTEIHGVRRVLRNGTLVLMPFAAAAYHQDVHNTIYRCIASNSVGRIVSRDVQVRA 127
            ..| ..:|:.:....|.|..|..|.||:|....|   ||.  .:|:|:|||.||.:||::..:|.
Mouse    73 YRW-KMNGTEMNLEPGSRHQLMGGNLVIMSPTKA---QDA--GVYQCLASNPVGTVVSKEAVLRF 131

  Fly   128 VVAQAY-KVDVEVLSAARGCTAILRCVVPTFVKELVRVVSWVHEPAIYI------YPS-LQGDGK 184
            ...|.: |.:.:.:....|...:|.|..|            .|.|.:..      :|: :..||:
Mouse   132 GFLQEFSKEERDPVKTHEGWGVMLPCNPP------------AHYPGLSYRWLLNEFPNFIPTDGR 184

  Fly   185 -FHLLPTGELLIHNLQESDESQSFRCRSMHRLTRQVVVSSPTRLRINSHRGIISPSVVEHTAHVQ 248
             |....||.|.|.....||.. ::.|.:                  .||....:.||....|.:.
Mouse   185 HFVSQTTGNLYIARTNASDLG-NYSCLA------------------TSHLDFSTKSVFSKFAQLN 230

  Fly   249 VSQDEGAVLLCVAQGCPSPEYSWFTHNGAGPLPVLSGPRVRLLGPILAIEAVTGEDSGVYKCTAG 313
            ::.::                                ||:                         
Mouse   231 LAAED--------------------------------PRL------------------------- 238

  Fly   314 NVGGEASAELRLTVATPIQVEISPNVLSVHMGGTAEFRCLVTSNGSPVGMQNILWYK-DGRQLPS 377
                         .|..|:....|...:: :|......|....|..|    .|.|.| ||...|.
Mouse   239 -------------FAPSIKARFPPETYAL-VGQQVTLECFAFGNPVP----RIKWRKVDGSLSPQ 285

  Fly   378 SGRVEDTLVVPRVSRENRGMYQCVVRRPEG-DTFQATAELQLGDAPPVLLYSFIEQTLQPGPAVS 441
            .|..|.||.:|.||.|:.|.|:|.....:| ||.|....:|   |.|..|....:.....|..:.
Mouse   286 WGTAEPTLQIPSVSFEDEGTYECEAENSKGRDTVQGRIIVQ---AQPEWLKVISDTEADIGSNLR 347

  Fly   442 LKCSAAGNPTPQISWTLDGFPLPSNGRFMIGQYITVHGDVISHVNISHVMVEDGGEYACIAENRA 506
            ..|:|||.|.|.:.|..:|.||.|..|..:     :.||    :..|.:.:||.|.|.|:|||:.
Mouse   348 WGCAAAGKPRPMVRWLRNGEPLASQNRVEV-----LAGD----LRFSKLNLEDSGMYQCVAENKH 403

  Fly   507 GRVQHAARLNIYGL-------PYIRLIPKVTAVSGETLNLKCPVAGYPIEEIHWERGGRELPDDI 564
            |.:..:|.|.:..|       |..||||   |..|..:::.|.....|...|.|.:|...|.:..
Mouse   404 GTIYASAELAVQALAPDFRQNPVRRLIP---AARGGEISIPCQPRAAPKATILWSKGTEILGNST 465

  Fly   565 RQRVQPDGSLTISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIVPPK--LSPFQTNILQLNMG 627
            |..|..||:|.|..:.: ||.|.|||:|.|..| .|..:|.::|....|  |:|...:|   |:|
Mouse   466 RVTVTLDGTLIIRNISR-SDEGKYTCFAENFMG-KANSTGILSVRDATKITLAPSSADI---NVG 525

  Fly   628 DRASLTCSVVKG-DLPLTINWRKDGRPID---PTQHMSVKQVDQYNSILVIENLGSDHTGNYSCV 688
            |..:|.|..... .:.||..|..|..|:|   |..|.....|.:....|.|.|....|.|.|:|:
Mouse   526 DNLTLQCHASHDPTMDLTFTWTLDDFPVDFDKPGGHYRRASVKETIGDLTILNAQLRHGGTYTCM 590

  Fly   689 VRNSAAEVENSQALLVNVPPRWIVEPVDANVERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYE 753
            .:...........:||..||    .|....|.|:         .|..|..:.|.:...:.|    
Mouse   591 AQTVVDGASKEATVLVRGPP----GPPGGVVVRD---------IGDTTVQLSWSRGFDNHS---- 638

  Fly   754 EVRERPFTKLLGNGSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVK 818
                 |..|                   |..||..   ...||..|::.|               
Mouse   639 -----PIAK-------------------YTLQART---PPSGKWKQVRTN--------------- 661

  Fly   819 KGDTALLQCAVSGDKPINIVWMRSGKNTLN--PSTNYKISVKQE-----ATPDGVSAELQIRTVD 876
                           |:||.........|.  |..:|:..|...     ..|.|.|:  :|||.:
Mouse   662 ---------------PVNIEGNAETAQVLGLMPWMDYEFRVSASNILGTGEPSGPSS--RIRTKE 709

  Fly   877 ATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQP--KTLGTGDVTKY 939
            |.                          |.:.||.|.....:...:.|.|.|  :....||...|
Mouse   710 AV--------------------------PSVAPSGLSGGGGAPGELTINWTPMSREYQNGDGFGY 748

  Fly   940 IVEFREADHSLPPALFVDQWQQIEV--KDPPHFNAMIENLKPATRYAFRVIAEGSAGRSAPSQEL 1002
            ::.||....|        .||...|  .|..:|....:::.|.|.:..::.:....|....|...
Mouse   749 LLSFRRQGSS--------SWQTARVPGADTQYFVYSNDSIHPYTPFEVKIRSYNRRGDGPESLTA 805

  Fly  1003 IVRTEPQRPAGPPLSLSARPLSSTELLISWVAPLPELRHGDIQGYNVGYKLSSSGNTAYNFTSVS 1067
            ||.:..:.|...|..:.|:..||:|:.:||...|.:: :|.:.||.:.|..:.....|.:....:
Mouse   806 IVYSAEEEPKVAPAKVWAKGSSSSEMNVSWEPVLQDM-NGILLGYEIRYWKAGDKEAAADRVRTA 869

  Fly  1068 GDGDGGNGELLLSGLAKFARYTVVVQAFNQVGPGPLSEPTAAQTMEDVPSRPPEDVRCAALSSQS 1132
            |......    ::||....:|.|.|:|:|:.|.||.|....|.||:..|.|||.::.. ..||.|
Mouse   870 GLDSSAR----VTGLYPNTKYHVTVRAYNRAGTGPASPSADAMTMKPPPRRPPGNISW-TFSSSS 929

  Fly  1133 LQVSWQPPPIYHTNGLLQGYKLIFEPIIDDIQP-------SKDEVESRKTTALTMVLTGLRKYTN 1190
            |.:.|.|.........:.|||::::   :|:||       ||:.:|......:...|        
Mouse   930 LSLKWDPVVPLRNESTVTGYKMLYQ---NDLQPTPMLHLTSKNWIEIPVPEDIGHAL-------- 983

  Fly  1191 YSIQVLAHTRMGDGVVSKPLFCHSEEDVPEAPADIKVVSSSSQSLYI--SWLPPNEPNGVIT 1250
              :|:......|||:                ||::.:|.:...|:.:  |.:.|..|..|.:
Mouse   984 --VQIRTTGPGGDGI----------------PAEVHIVRNGGTSMMVESSAVRPAHPGPVFS 1027

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 30..128 CDD:472250 35/99 (35%)
Ig strand B 49..53 CDD:409353 1/3 (33%)
Ig strand C 62..66 CDD:409353 1/3 (33%)
Ig strand E 86..90 CDD:409353 2/3 (67%)
Ig strand F 106..111 CDD:409353 2/4 (50%)
Ig strand G 119..123 CDD:409353 2/3 (67%)
V-set 138..229 CDD:462230 17/98 (17%)
Ig 238..327 CDD:472250 5/88 (6%)
Ig strand B 255..259 CDD:409353 0/3 (0%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 293..297 CDD:409353 0/3 (0%)
Ig strand F 307..312 CDD:409353 0/4 (0%)
Ig strand G 320..323 CDD:409353 0/2 (0%)
Ig 330..418 CDD:472250 27/89 (30%)
Ig strand B 348..352 CDD:409353 0/3 (0%)
Ig strand C 365..369 CDD:409353 1/3 (33%)
Ig strand E 383..387 CDD:409353 2/3 (67%)
Ig strand F 397..402 CDD:409353 2/4 (50%)
Ig strand G 411..414 CDD:409353 1/2 (50%)
IgI_4_Dscam 422..517 CDD:409548 29/94 (31%)
Ig strand A 422..425 CDD:409548 1/2 (50%)
Ig strand A' 431..435 CDD:409548 0/3 (0%)
Ig strand B 438..447 CDD:409548 1/8 (13%)
Ig strand C 452..458 CDD:409548 2/5 (40%)
Ig strand C' 460..463 CDD:409548 1/2 (50%)
Ig strand D 468..476 CDD:409548 1/7 (14%)
Ig strand E 480..489 CDD:409548 1/8 (13%)
Ig strand F 496..504 CDD:409548 4/7 (57%)
Ig strand G 507..517 CDD:409548 3/9 (33%)
IgI_5_Dscam 521..608 CDD:409550 30/86 (35%)
Ig strand A 521..523 CDD:409550 1/1 (100%)
Ig strand A' 528..532 CDD:409550 0/3 (0%)
Ig strand B 535..542 CDD:409550 0/6 (0%)
Ig strand C 549..555 CDD:409550 2/5 (40%)
Ig strand C' 556..558 CDD:409550 1/1 (100%)
Ig strand D 565..569 CDD:409550 1/3 (33%)
Ig strand E 572..578 CDD:409550 3/5 (60%)
Ig strand F 586..594 CDD:409550 5/7 (71%)
Ig strand G 598..608 CDD:409550 2/9 (22%)
Ig 611..704 CDD:472250 25/98 (26%)
Ig strand B 630..634 CDD:409353 1/3 (33%)
Ig strand C 644..648 CDD:409353 1/3 (33%)
Ig strand E 670..674 CDD:409353 1/3 (33%)
Ig strand F 684..689 CDD:409353 2/4 (50%)
Ig strand G 697..700 CDD:409353 0/2 (0%)
IgI_7_Dscam 707..802 CDD:409546 17/94 (18%)
Ig strand A 707..711 CDD:409546 2/3 (67%)
Ig strand A' 716..720 CDD:409546 0/3 (0%)
Ig strand B 723..732 CDD:409546 0/8 (0%)
Ig strand C 738..744 CDD:409546 1/5 (20%)
Ig strand C' 750..753 CDD:409546 0/2 (0%)
Ig strand D 761..764 CDD:409546 1/2 (50%)
Ig strand E 767..773 CDD:409546 0/5 (0%)
Ig strand F 780..788 CDD:409546 3/7 (43%)
Ig strand G 793..802 CDD:409546 3/8 (38%)
Ig 806..892 CDD:472250 14/92 (15%)
Ig strand B 823..827 CDD:409353 0/3 (0%)
Ig strand C 836..840 CDD:409353 2/3 (67%)
Ig strand E 868..872 CDD:409353 0/3 (0%)
Ig strand F 882..887 CDD:409353 0/4 (0%)
FN3 <904..1195 CDD:442628 73/301 (24%)
FN3 906..1006 CDD:238020 23/103 (22%)
fn3 1221..1306 CDD:394996 8/32 (25%)
Ig 1336..1396 CDD:409353
Ig strand B 1336..1340 CDD:409353
Ig strand E 1371..1375 CDD:409353
Ig strand F 1385..1390 CDD:409353
FN3 <1407..>1606 CDD:442628
fn3 1408..1491 CDD:394996
Cntn2NP_796103.2 Ig 37..133 CDD:472250 35/101 (35%)
Ig strand B 59..63 CDD:409437 1/3 (33%)
Ig strand C 72..76 CDD:409437 2/4 (50%)
Ig strand E 95..99 CDD:409437 2/3 (67%)
Ig strand F 110..115 CDD:409437 2/4 (50%)
Ig strand G 124..127 CDD:409437 1/2 (50%)
Ig2_Contactin-2-like 141..230 CDD:409392 22/119 (18%)
Ig strand A 143..148 CDD:409392 0/4 (0%)
Ig strand B 152..158 CDD:409392 1/5 (20%)
Ig strand C 166..172 CDD:409392 0/5 (0%)
Ig strand C' 177..179 CDD:409392 0/1 (0%)
Ig strand D 184..189 CDD:409392 1/4 (25%)
Ig strand E 192..196 CDD:409392 2/3 (67%)
Ig strand F 206..214 CDD:409392 1/25 (4%)
Ig strand G 218..230 CDD:409392 3/11 (27%)
Ig 241..326 CDD:472250 27/89 (30%)
Ig strand B 259..263 CDD:409357 0/3 (0%)
Ig strand C 272..276 CDD:409357 1/3 (33%)
Ig strand E 291..295 CDD:409357 2/3 (67%)
Ig strand F 305..310 CDD:409357 2/4 (50%)
Ig strand G 318..321 CDD:409357 1/2 (50%)
Ig4_Contactin-2-like 330..414 CDD:143205 28/92 (30%)
Ig strand A 330..333 CDD:143205 0/2 (0%)
Ig strand A' 337..341 CDD:143205 0/3 (0%)
Ig strand B 345..353 CDD:143205 1/7 (14%)
Ig strand C 359..364 CDD:143205 1/4 (25%)
Ig strand C' 366..369 CDD:143205 1/2 (50%)
Ig strand D 374..378 CDD:143205 1/8 (13%)
Ig strand E 380..385 CDD:143205 2/8 (25%)
Ig strand F 394..401 CDD:143205 3/6 (50%)
Ig strand G 405..414 CDD:143205 2/8 (25%)
Ig5_Contactin 419..507 CDD:409358 30/92 (33%)
Ig strand A 419..424 CDD:409358 0/4 (0%)
Ig strand A' 427..432 CDD:409358 4/7 (57%)
Ig strand B 436..443 CDD:409358 0/6 (0%)
Ig strand C 451..455 CDD:409358 1/3 (33%)
Ig strand D 469..472 CDD:409358 1/2 (50%)
Ig strand E 473..478 CDD:409358 2/4 (50%)
Ig strand F 486..494 CDD:409358 5/7 (71%)
Ig strand G 500..507 CDD:409358 1/6 (17%)
Ig 509..605 CDD:472250 25/98 (26%)
Ig strand B 528..532 CDD:409440 1/3 (33%)
Ig strand C 543..547 CDD:409440 1/3 (33%)
Ig strand E 572..576 CDD:409440 1/3 (33%)
Ig strand F 586..591 CDD:409440 2/4 (50%)
Ig strand G 599..602 CDD:409440 0/2 (0%)
FN3 620..707 CDD:238020 24/158 (15%)
FN3 728..808 CDD:238020 19/87 (22%)
Cell attachment site. /evidence=ECO:0000255 796..798 0/1 (0%)
FN3 817..909 CDD:238020 26/96 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 897..922 11/24 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.