DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and zig-2

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:214 Identity:55/214 - (25%)
Similarity:87/214 - (40%) Gaps:29/214 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 DAPPVLLYSFI--EQTLQPGPAVSLKCSAAGNPTPQISWTLDGFPLPSNGRFMI-------GQYI 475
            |:.|:|.::..  :..:..|....|.|.|.|.|.|.|.|.|:|..:.......:       |:.:
 Worm    28 DSQPLLKFTRTPNDSNVTFGEKFVLSCGANGAPLPSIYWELNGMRIQGEETSNVYENILNDGKQV 92

  Fly   476 TVHGDVISHVNISHVMVEDGGEYACIAENRAGRVQHAAR-----------LNIYGLPYIRL-IPK 528
            :....|.||..|......:.|.|.||.:|...:::|.|:           ||..|.|:|.: :..
 Worm    93 SNAAMVSSHYRIPCATARNSGAYKCIIDNGLTKLEHVAKVFVGGNKTNCALNDNGAPFISMTVDF 157

  Fly   529 VTAVSGETLNLKCPVAGYPIEEIHWERGGRELPDD-IRQRVQPDGSLTISPVQKNSDSGVYTCWA 592
            ...:|...:.|.|  ......|..|.:|.:.|.:| .|.::.|.|.|.|..:.. ||.|.|.|.|
 Worm   158 RLEISNNAVALSC--RSETATEWSWHKGEQLLTNDGERYQMFPSGDLIIRNISW-SDMGEYNCTA 219

  Fly   593 RNKQGHSARRSGEVTVIVP 611
            ||..|.:.    .:|.:.|
 Worm   220 RNHFGETT----AITFLYP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653 24/102 (24%)
IGc2 436..507 CDD:197706 21/77 (27%)
I-set 521..610 CDD:254352 25/90 (28%)
IGc2 533..597 CDD:197706 21/64 (33%)
Ig 630..699 CDD:143165
IG_like 714..802 CDD:214653
Ig 725..802 CDD:299845
Ig 823..894 CDD:143165
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
zig-2NP_510069.1 I-set 34..134 CDD:254352 23/99 (23%)
Ig 34..121 CDD:299845 20/86 (23%)
Ig <179..232 CDD:299845 19/57 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.