DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and C53A5.13

DIOPT Version :10

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_001256598.1 Gene:C53A5.13 / 179961 WormBaseID:WBGene00008270 Length:681 Species:Caenorhabditis elegans


Alignment Length:697 Identity:133/697 - (19%)
Similarity:240/697 - (34%) Gaps:208/697 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1081 GLAKFARYTVVVQAFNQVGPGPLSEPTAAQTMEDVP-SRPPEDVRCAALSSQSLQVSWQPPPI-- 1142
            |||....|.:.|:||........:...|..::..:| ...|.::......::|::|||.||.:  
 Worm    91 GLAGNTTYRLSVEAFKNETSLWYASNMATTSLAALPWLHAPSELTLMDRKNESIEVSWIPPVVLE 155

  Fly  1143 --YH---TNGLLQGYKLIFEPIIDDIQPSKDEVESRKTTALTMVLT-----GLRKYTNYSIQVLA 1197
              :|   |..|::.|.|           |.:...::::..:.:.||     ||:..|.|::.|.|
 Worm   156 AGHHFIITQHLVKVYDL-----------SGNSSTNKRSITVPIPLTRLQIDGLKPATAYNVTVQA 209

  Fly  1198 HTRMGDGVVSKPLFCHSEEDVPEAPADIKVVSSSSQSLYISWLPPNEPNGVITKYSLYTRVVNG- 1261
            .|..|.|  :|.....:..|..||.. :|:.|.:..||.:.| |.|......:|:::..:.::. 
 Worm   210 GTSYGYG--NKVWCAFATLDSDEANI-LKLRSRTPNSLTVYW-PANWLTKTTSKFTIKAKTIHSP 270

  Fly  1262 ---REELNNEKRSLPSQQAYYEAKGLHPHMEYQFWVTASTRVGEGKSSRVSSQITTNRIPARIIS 1323
               .:|:.|.....|.:...:....|.|...|...:|.|           ..|:..         
 Worm   271 TGVSKEIENSAIGEPGKAHEFVVDNLLPSSTYNITITTS-----------DDQLKN--------- 315

  Fly  1324 FGGPVVRPWRSTVTLPCTAVGKPKREW--FKSDVALRQG--GLHNSQLLDSGDLIIS----SLQL 1380
             ||   :.|...         :.|..|  |.:   :.||  |:..::::...|..:|    .|:|
 Worm   316 -GG---KKWTQM---------RWKHGWAVFST---MSQGEYGVAEARIVVETDFAVSIVFQPLKL 364

  Fly  1381 ADGGNYSCQVDNGI---GTDRLTHTLIVQVPPTAPVLYVTSATSSSIL-----MHWKCGFTGN-- 1435
            | |.|.:.|:...:   .:.::|:.|                |.|::.     ..|||....|  
 Worm   365 A-GRNITYQIKYTLKDRNSSQITNEL----------------TDSNLKCPKFECQWKCALIFNLP 412

  Fly  1436 ---------------------APITGYTLFYRRANGNTDEMQLSRHASSH---ELKGLMCGSTYQ 1476
                                 :|:|     .|:.|      .|.|..|.|   :|.|.:...|.|
 Worm   413 HRPREYKFEIRAKVDNVWNRWSPVT-----LRQWN------LLERVCSIHPPSDLVGHLGDYTRQ 466

  Fly  1477 IHLSAQNKVGTSPTSTILHVRTQGQSPGHPASTALLAPNSTSLLVRLHSWPDNGCPLLYFVLQYR 1541
            ..:..|:                       |....:| :....:|.:.|.|.:..|:....|..|
 Worm   467 RDIDVQS-----------------------AKVPQIA-DVWRYMVVVDSRPYDLAPIDITKLADR 507

  Fly  1542 AVTDDPDAEWVLVSNALKPQR-------RIVINNLQPSTL-YQLRMEAH---NVAGISQAEFNFV 1595
             .|.:.|.....::.||.|:.       ||....:....| |.||.|..   .:..::|:|...:
 Worm   508 -TTSEADHVPYYITAALTPEEVKNHGDFRIGDGKIYGGYLNYPLRTEIDPRWTLIPVTQSENEMI 571

  Fly  1596 TLTKDGDPPPPEIMHRGRSGQTT----VIFANINLLIPTIAAVSGMFCTIIMI------IVCY-R 1649
                     .|.:...|.:.|.|    :..:.:...||.:...:|....|::|      :.|: |
 Worm   572 ---------EPHLKTCGFNEQGTFKCDMSISEVFTQIPIVLVSAGFLILILVIFLMCLLVFCFLR 627

  Fly  1650 HMLKNAPPLAEQSQIQKES--------------LENRANSEAAQRER 1682
            :..::.|.:.|.:.:...|              :|.|..:.|...||
 Worm   628 NSCQDRPGVKESALMYYRSDSPNTISTCREYRKIERREFNAADMEER 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 30..128 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand E 86..90 CDD:409353
Ig strand F 106..111 CDD:409353
Ig strand G 119..123 CDD:409353
V-set 138..229 CDD:462230
Ig 238..327 CDD:472250
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 293..297 CDD:409353
Ig strand F 307..312 CDD:409353
Ig strand G 320..323 CDD:409353
Ig 330..418 CDD:472250
Ig strand B 348..352 CDD:409353
Ig strand C 365..369 CDD:409353
Ig strand E 383..387 CDD:409353
Ig strand F 397..402 CDD:409353
Ig strand G 411..414 CDD:409353
IgI_4_Dscam 422..517 CDD:409548
Ig strand A 422..425 CDD:409548
Ig strand A' 431..435 CDD:409548
Ig strand B 438..447 CDD:409548
Ig strand C 452..458 CDD:409548
Ig strand C' 460..463 CDD:409548
Ig strand D 468..476 CDD:409548
Ig strand E 480..489 CDD:409548
Ig strand F 496..504 CDD:409548
Ig strand G 507..517 CDD:409548
IgI_5_Dscam 521..608 CDD:409550
Ig strand A 521..523 CDD:409550
Ig strand A' 528..532 CDD:409550
Ig strand B 535..542 CDD:409550
Ig strand C 549..555 CDD:409550
Ig strand C' 556..558 CDD:409550
Ig strand D 565..569 CDD:409550
Ig strand E 572..578 CDD:409550
Ig strand F 586..594 CDD:409550
Ig strand G 598..608 CDD:409550
Ig 611..704 CDD:472250
Ig strand B 630..634 CDD:409353
Ig strand C 644..648 CDD:409353
Ig strand E 670..674 CDD:409353
Ig strand F 684..689 CDD:409353
Ig strand G 697..700 CDD:409353
IgI_7_Dscam 707..802 CDD:409546
Ig strand A 707..711 CDD:409546
Ig strand A' 716..720 CDD:409546
Ig strand B 723..732 CDD:409546
Ig strand C 738..744 CDD:409546
Ig strand C' 750..753 CDD:409546
Ig strand D 761..764 CDD:409546
Ig strand E 767..773 CDD:409546
Ig strand F 780..788 CDD:409546
Ig strand G 793..802 CDD:409546
Ig 806..892 CDD:472250
Ig strand B 823..827 CDD:409353
Ig strand C 836..840 CDD:409353
Ig strand E 868..872 CDD:409353
Ig strand F 882..887 CDD:409353
FN3 <904..1195 CDD:442628 28/126 (22%)
FN3 906..1006 CDD:238020
fn3 1221..1306 CDD:394996 17/88 (19%)
Ig 1336..1396 CDD:409353 14/70 (20%)
Ig strand B 1336..1340 CDD:409353 0/3 (0%)
Ig strand E 1371..1375 CDD:409353 1/3 (33%)
Ig strand F 1385..1390 CDD:409353 1/4 (25%)
FN3 <1407..>1606 CDD:442628 41/240 (17%)
fn3 1408..1491 CDD:394996 19/113 (17%)
C53A5.13NP_001256598.1 fn3 130..216 CDD:394996 23/96 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.