| Sequence 1: | NP_001261500.1 | Gene: | Dscam2 / 38788 | FlyBaseID: | FBgn0265296 | Length: | 2101 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_499714.1 | Gene: | zig-8 / 176732 | WormBaseID: | WBGene00006985 | Length: | 268 | Species: | Caenorhabditis elegans |
| Alignment Length: | 259 | Identity: | 71/259 - (27%) |
|---|---|---|---|
| Similarity: | 99/259 - (38%) | Gaps: | 52/259 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 689 VRNSAAEVENSQALLVNVPPRWIVEPVDANVERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYE 753
Fly 754 EVRERPFT---------KLLGNGSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSPYFS 809
Fly 810 STSRSVMVKK---------GDTALLQCAV-SGDKP---INIVWMRSGKNTL--NPSTNYKISVKQ 859
Fly 860 EATPDGVSAE-LQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSV 922 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Dscam2 | NP_001261500.1 | Ig | 51..127 | CDD:299845 | |
| Ig | 138..>203 | CDD:299845 | |||
| I-set | 238..327 | CDD:254352 | |||
| Ig | 247..327 | CDD:299845 | |||
| I-set | 332..418 | CDD:254352 | |||
| IGc2 | 344..407 | CDD:197706 | |||
| IG_like | 432..517 | CDD:214653 | |||
| IGc2 | 436..507 | CDD:197706 | |||
| I-set | 521..610 | CDD:254352 | |||
| IGc2 | 533..597 | CDD:197706 | |||
| Ig | 630..699 | CDD:143165 | 3/9 (33%) | ||
| IG_like | 714..802 | CDD:214653 | 21/96 (22%) | ||
| Ig | 725..802 | CDD:299845 | 19/85 (22%) | ||
| Ig | 823..894 | CDD:143165 | 27/77 (35%) | ||
| FN3 | 906..1006 | CDD:238020 | 4/17 (24%) | ||
| FN3 | 1013..1111 | CDD:238020 | |||
| FN3 | 1119..1209 | CDD:238020 | |||
| FN3 | 1219..1313 | CDD:238020 | |||
| Ig | 1336..1402 | CDD:143165 | |||
| FN3 | 1409..1498 | CDD:238020 | |||
| FN3 | 1515..1588 | CDD:238020 | |||
| zig-8 | NP_499714.1 | IG_like | 55..134 | CDD:214653 | 19/83 (23%) |
| Ig | 55..129 | CDD:143165 | 18/78 (23%) | ||
| ig | 158..229 | CDD:278476 | 28/74 (38%) | ||
| IG_like | 158..227 | CDD:214653 | 27/72 (38%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||