DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and Il1rap

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_001152790.1 Gene:Il1rap / 16180 MGIID:104975 Length:685 Species:Mus musculus


Alignment Length:733 Identity:146/733 - (19%)
Similarity:231/733 - (31%) Gaps:240/733 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 WTLD--------GFPLPSNGRFMIGQYITVHGDVISHVNISHVMVEDGGEYACIAEN-------- 504
            ||..        .|.||.|       .|:...||:.   ....::.|.|.|.|:..|        
Mouse    72 WTRQDRDLEEPINFRLPEN-------RISKEKDVLW---FRPTLLNDTGNYTCMLRNTTYCSKVA 126

  Fly   505 -------RAGRVQHAARLNIYGLPYIRLIPKVTAVSGETLNLKCP-VAGY-PIE---EIHWERGG 557
                   :......|.|..::.:.....|.|:|          || |.|| |..   .:.|.:|.
Mouse   127 FPLEVV
QKDSCFNSAMRFPVHKMYIEHGIHKIT----------CPNVDGYFPSSVKPSVTWYKGC 181

  Fly   558 RELPDDIRQRVQPDGSLTISPVQKNSDSGVYTC---WARNKQGHSARRSGEVTVI------VPPK 613
            .|:.|  ...|.|:|......:...|::|.|||   :..|.:.....|:..|.|:      :||:
Mouse   182 TEIVD--FHNVLPEGMNLSFFIPLVSNNGNYTCVVTYPENGRLFHLTRTVTVKVVGSPKDALPPQ 244

  Fly   614 L-SPFQTNILQLNMGDRASLTCSVVKG---DLPLTINWRKDG-RPIDPTQHMSVKQVDQYNS--- 670
            : ||....:.:...|:...:.|.|...   |....:.|..|| :|.|.|..:::.:...|:|   
Mouse   245 IYSPNDRVVYEKEPGEELVIPCKVYFSFIMDSHNEVWWTIDGKKPDDVTVDITINESVSYSSTED 309

  Fly   671 -----ILVIENL-GSDHTGNYSCVVRNSAAEVENSQALLVN---VPPRWIVEPVDANVERNRHIM 726
                 ||.|:.: ..|...||.|..||:..|.|  ||..|.   :|||:.||             
Mouse   310 ETRTQILSIKKVTPEDLRRNYVCHARNTKGEAE--QAAKVKQKVIPPRYTVE------------- 359

  Fly   727 LHCQAQG--------VPTPSIVWKK------------ATGSKSGEYE-------EVRERPFTKLL 764
            |.|....        :....:.|.:            .|.....||:       .|.|..|.   
Mouse   360 LACGFGATVFLVVVLIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNVEEEEFV--- 421

  Fly   765 GNGSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAV 829
               .|.|:.|.|:..|:.||..:.....| |..::...:   :...:.|.::|...|...     
Mouse   422 ---LLTLRGVLENEFGYKLCIFDRDSLPG-GNTVEAVFD---FIQRSRRMIVVLSPDYVT----- 474

  Fly   830 SGDKPINIVWMRSGKNTLNPSTNYKISVK----QEATPDGVSAELQIRTVD-----ATDSGPYFC 885
              :|.|:::..:.|....|......|.|:    ::..|..:..:..:..|.     :..||..|.
Mouse   475 --EKSISMLEFKLGVMCQNSIATKLIVVEYRPLEQPHPGIMQLKESVSFVSWKGEKSKHSGSKFW 537

  Fly   886 RASNLYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDVTKYIVEFREADHSL 950
            :|..|                       |..:.|.|.:..|........|::...|:.|.     
Mouse   538 KALRL-----------------------ALPLRSLSASSGWNESCSSQSDISLDHVQRRS----- 574

  Fly   951 PPALFVDQWQQIEVKDPPHFNA--MIENLKPA--TRYAFR-----------VIAEGSAG-RSAPS 999
                        .:|:||...:  .:...:||  |....|           ...||.:. ||...
Mouse   575 ------------RLKEPPELRSSERVSGAEPAPGTMSKHRGKPSAACRCCVTYCEGESHLRSKSR 627

  Fly  1000 QELIVRTEPQRPAGPPLSLSARPLSSTELLISWV------APLPE-----LRHGDIQGYNVGYKL 1053
            .|:  .|.||...    .|...||..:|  ..|:      .|.|:     |||            
Mouse   628 AEM--HTHPQWET----HLCKPPLQESE--SQWIQNGTRPEPAPQISALALRH------------ 672

  Fly  1054 SSSGNTAYNFTSVSGDGD 1071
                     ||.:|.:.|
Mouse   673 ---------FTDLSNNND 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653 16/83 (19%)
IGc2 436..507 CDD:197706 14/73 (19%)
I-set 521..610 CDD:254352 25/102 (25%)
IGc2 533..597 CDD:197706 19/71 (27%)
Ig 630..699 CDD:143165 22/81 (27%)
IG_like 714..802 CDD:214653 18/114 (16%)
Ig 725..802 CDD:299845 18/103 (17%)
Ig 823..894 CDD:143165 13/79 (16%)
FN3 906..1006 CDD:238020 19/115 (17%)
FN3 1013..1111 CDD:238020 14/70 (20%)
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Il1rapNP_001152790.1 Ig1_IL1R_like 25..132 CDD:409584 14/69 (20%)
Ig strand B 43..47 CDD:409584
Ig strand C 67..71 CDD:409584
Ig strand E 97..101 CDD:409584 2/6 (33%)
Ig strand F 111..116 CDD:409584 2/4 (50%)
Ig strand G 124..127 CDD:409584 0/2 (0%)
Ig 145..235 CDD:416386 25/101 (25%)
Ig strand A 145..150 CDD:409353 0/4 (0%)
Ig strand A 145..150 CDD:409353 0/4 (0%)
Ig strand B 156..160 CDD:409353 2/13 (15%)
Ig strand B 156..160 CDD:409353 2/13 (15%)
Ig strand C 174..179 CDD:409353 1/4 (25%)
Ig strand C 174..179 CDD:409353 1/4 (25%)
Ig strand C' 182..184 CDD:409353 0/1 (0%)
Ig strand C' 182..184 CDD:409353 0/1 (0%)
Ig strand D 189..193 CDD:409353 1/3 (33%)
Ig strand D 189..193 CDD:409353 1/3 (33%)
Ig strand E 195..200 CDD:409353 0/4 (0%)
Ig strand E 195..200 CDD:409353 0/4 (0%)
Ig strand F 209..218 CDD:409353 3/8 (38%)
Ig strand F 209..218 CDD:409353 3/8 (38%)
Ig strand G 221..234 CDD:409353 2/12 (17%)
Ig strand G 221..234 CDD:409353 2/12 (17%)
Ig3_IL1RAP 243..349 CDD:409525 29/107 (27%)
Ig strand B 262..266 CDD:409525 0/3 (0%)
Ig strand C 279..283 CDD:409525 0/3 (0%)
Ig strand E 314..318 CDD:409525 2/3 (67%)
Ig strand F 329..334 CDD:409525 3/4 (75%)
Ig strand G 341..344 CDD:409525 1/4 (25%)
TIR 404..547 CDD:214587 31/182 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.