DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and Cntn5

DIOPT Version :10

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_446198.1 Gene:Cntn5 / 114589 RGDID:621302 Length:1099 Species:Rattus norvegicus


Alignment Length:1077 Identity:266/1077 - (24%)
Similarity:444/1077 - (41%) Gaps:178/1077 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 CLVTSNGSPVGMQNILWYKDGRQ--LPSSGR---VEDTLVV--PRVSRENRGMYQCVVRRPEGDT 409
            |.|..|.||    ...|.::|.:  |.|..|   ::.|.::  |..||:: |:|||:.....|..
  Rat   123 CEVRGNPSP----TYRWLRNGTEIDLESDYRYSMIDGTFIINNPSESRDS-GLYQCLATNTFGSI 182

  Fly   410 FQATAELQLGDAPPVLLYSFIEQT-----LQPGPAVSLKCSAAGNPTPQI--SWTLDGFP--LPS 465
            ....|.||.     ..|.:|..:|     ::.|..|.|.||...: :|:|  ||..:.||  :..
  Rat   183 LSREATLQF-----AYLGNFSGRTRSAVSVREGQGVVLMCSPPPH-SPEIIYSWVFNEFPSFVAE 241

  Fly   466 NGRFMIGQYITVHGDVISHVNISHVMVEDGGEYACIAENRA--GRV----------------QHA 512
            :.|..|.|       ...::.||.|...|.|.|.|:.:|..  .||                ::.
  Rat   242 DSRRFISQ-------ETGNLYISKVQTSDVGSYICLVKNAVTNARVLSPPTPLTLRNDGVMGEYE 299

  Fly   513 ARLNIYGLPYIRLIPKVTAVSGETLNLKCPVAGYPIEEIHWERGGRELPDDIRQRVQPDGSLTIS 577
            .::.:: .|     ..|||..|.|:.::|...|.|:..|.|.:....:|...|.| :....|.|.
  Rat   300 PKIEVH-FP-----TTVTAAKGTTVKMECFALGNPVPTITWMKVNGYIPSKSRLR-KSQAVLEIP 357

  Fly   578 PVQKNSDSGVYTCWARNKQGHSARRSGEVTVIVPP----KLSPFQTNILQLNMGDRASLTCSVVK 638
            .:|.: |:|:|.|.|.|.:|.::.| |::.:...|    ||     |..||:.|......|....
  Rat   358 NLQLD-DAGIYECTAENSRGKNSFR-GQLQIYTYPHWVQKL-----NDTQLDSGSPLQWECKATG 415

  Fly   639 GDLPLTINWRKDGRPIDPTQHMSVKQVDQYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQAL- 702
            ...| |..|.|:|.|:.|.     .:||..|.:|.|.::.....|.|.|:..|....:..|..| 
  Rat   416 KPRP-TYRWLKNGAPLLPQ-----SRVDTANGVLAIHSVNQSDAGMYQCLAENKYGAIYASAELK 474

  Fly   703 LVNVPPRWIVEPVDAN--VERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLG 765
            ::..||.:.:..|..:  |.::|.:::.|:.||.|.|:|.|:|  |.|:     ||......:|.
  Rat   475 ILASPPSFELNQVKKSIIVTKDREVLIECKPQGSPKPAISWRK--GDKA-----VRGNKRIAILP 532

  Fly   766 NGSLLLQHVKEDREGFYLCQANNGIGTGIGKVI-QLKVNSSPYFSSTSRSVMVKKGDTALLQCAV 829
            :|||.:.:..:..||.|:||..|..|:  .::| .:.|........|.:...:..|::.:|.|..
  Rat   533 DGSLRILNASKADEGKYICQGVNIFGS--AEIIASVSVKEPTRIELTPKRTELTVGESIVLNCKA 595

  Fly   830 SGDKPINIV--WMRSGKN-TLNPSTNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLY 891
            ..|..:::.  |...|:. .......:..|::.:|:    ||:|.||.:....:|.|.||.....
  Rat   596 MHDSSLDVTFYWTLKGQPIDFEKEGGHFESIRAQAS----SADLMIRNILLMHAGRYGCRVQTTA 656

  Fly   892 GNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDVTKYIVEFREADHSLPPALFV 956
            .:.....:|.|:.||.||.|:....|:..:..:.|.|.|.....::.|.::.|..        |.
  Rat   657 DSVSDEAELLVRGPPGPPGVVIVEEITESTATLSWSPATDNHSPISSYNLQARSP--------FS 713

  Fly   957 DQWQQIEVKDPPHF------NAMIENLKPATRYAFRVIAEGSAGRSAPS-QELIVRTEPQRPAGP 1014
            ..||  .||..|..      :||..:|.|...|.|||:|....|...|| ...::||....|...
  Rat   714 LGWQ--TVKTVPEVITGDMESAMAVDLNPWVEYEFRVVATNPIGTGDPSIPSRMIRTNEAVPKTA 776

  Fly  1015 PLSLSARPLSSTELLISWVAPLPELRHGDIQGYNVGYKLSSSGNTAYNFTSVSGDGDGGNGELLL 1079
            |.::|.......||:|:|.....|.::|:..||.|.::  .:|...:....|:.           
  Rat   777 PSNVSGGSGRRHELVIAWEPVSEEFQNGEGFGYIVAFR--PNGTRGWKEKMVTS----------- 828

  Fly  1080 SGLAKF----------ARYTVVVQAFNQVGPGPLSEPTAAQTMEDVPSRPPEDVRCAALSSQSLQ 1134
            |..:||          ..:.|.|..:|..|.||.|:.....:.|..|:..|.||...::|...:.
  Rat   829 SDASKFIYRDESVPPLTPFEVKVGVYNNKGDGPFSQIVVICSAEGEPTAAPTDVTATSVSVSEIF 893

  Fly  1135 VSWQPPPIYHTNGLLQGYKLIF----EPIIDDIQPSKDEVESRKTTALTMVLTGLRKYTNYSIQV 1195
            |.|:  .:..:.|..||:::.:    ||     :.|.:.|.:|...:..| ||||...|.|.:.|
  Rat   894 VVWK--HVKESLGRPQGFEIGYWKDTEP-----EDSAETVRTRGNESFVM-LTGLEGDTLYHLTV 950

  Fly  1196 LAHTRMGDGVVSKPLFCHSEEDVP-EAPADIKVVSSSSQSLYISWLP--PNEPNGVITKYSLYTR 1257
            .|:...|.|..|:.:...::...| |.|.:::.....|| :.:.|.|  |......:..|.::. 
  Rat   951 RAYNGAGYGPPSREVSATTKRHPPSEPPGNLRWEQQGSQ-VSLGWEPVRPLANESEVMGYKVFY- 1013

  Fly  1258 VVNGREELNNEKRSLPSQQAYYEAKGLHPHMEYQFWVTASTRVGEGKSSRVSSQITTNRIPARII 1322
                |:|.:::.:.:.:|    :.:.:.|..|...::.......||.....||||   |:|:.. 
  Rat  1014 ----RQEGHSKGQVIETQ----KPQAVVPLPEAGVYIIEVRAYSEGGDGTASSQI---RVPSYA- 1066

  Fly  1323 SFGGPV---------VRPWRSTVTLPCTAVGKPKREW 1350
              ||.:         :..| |:||| ..|:..|...|
  Rat  1067 --GGKITSAQSTLHSLSKW-SSVTL-LLALMLPSSSW 1099

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 30..128 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand E 86..90 CDD:409353
Ig strand F 106..111 CDD:409353
Ig strand G 119..123 CDD:409353
V-set 138..229 CDD:462230
Ig 238..327 CDD:472250
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 293..297 CDD:409353
Ig strand F 307..312 CDD:409353
Ig strand G 320..323 CDD:409353
Ig 330..418 CDD:472250 21/72 (29%)
Ig strand B 348..352 CDD:409353 266/1077 (25%)
Ig strand C 365..369 CDD:409353 0/3 (0%)
Ig strand E 383..387 CDD:409353 1/3 (33%)
Ig strand F 397..402 CDD:409353 3/4 (75%)
Ig strand G 411..414 CDD:409353 0/2 (0%)
IgI_4_Dscam 422..517 CDD:409548 27/121 (22%)
Ig strand A 422..425 CDD:409548 0/2 (0%)
Ig strand A' 431..435 CDD:409548 1/8 (13%)
Ig strand B 438..447 CDD:409548 4/8 (50%)
Ig strand C 452..458 CDD:409548 4/7 (57%)
Ig strand C' 460..463 CDD:409548 2/4 (50%)
Ig strand D 468..476 CDD:409548 3/7 (43%)
Ig strand E 480..489 CDD:409548 1/8 (13%)
Ig strand F 496..504 CDD:409548 3/7 (43%)
Ig strand G 507..517 CDD:409548 2/25 (8%)
IgI_5_Dscam 521..608 CDD:409550 26/86 (30%)
Ig strand A 521..523 CDD:409550 1/1 (100%)
Ig strand A' 528..532 CDD:409550 2/3 (67%)
Ig strand B 535..542 CDD:409550 1/6 (17%)
Ig strand C 549..555 CDD:409550 2/5 (40%)
Ig strand C' 556..558 CDD:409550 0/1 (0%)
Ig strand D 565..569 CDD:409550 2/3 (67%)
Ig strand E 572..578 CDD:409550 2/5 (40%)
Ig strand F 586..594 CDD:409550 4/7 (57%)
Ig strand G 598..608 CDD:409550 2/9 (22%)
Ig 611..704 CDD:472250 26/97 (27%)
Ig strand B 630..634 CDD:409353 0/3 (0%)
Ig strand C 644..648 CDD:409353 1/3 (33%)
Ig strand E 670..674 CDD:409353 1/3 (33%)
Ig strand F 684..689 CDD:409353 2/4 (50%)
Ig strand G 697..700 CDD:409353 0/2 (0%)
IgI_7_Dscam 707..802 CDD:409546 29/97 (30%)
Ig strand A 707..711 CDD:409546 2/3 (67%)
Ig strand A' 716..720 CDD:409546 0/5 (0%)
Ig strand B 723..732 CDD:409546 2/8 (25%)
Ig strand C 738..744 CDD:409546 2/5 (40%)
Ig strand C' 750..753 CDD:409546 0/2 (0%)
Ig strand D 761..764 CDD:409546 0/2 (0%)
Ig strand E 767..773 CDD:409546 3/5 (60%)
Ig strand F 780..788 CDD:409546 4/7 (57%)
Ig strand G 793..802 CDD:409546 1/9 (11%)
Ig 806..892 CDD:472250 18/88 (20%)
Ig strand B 823..827 CDD:409353 1/3 (33%)
Ig strand C 836..840 CDD:409353 0/5 (0%)
Ig strand E 868..872 CDD:409353 2/3 (67%)
Ig strand F 882..887 CDD:409353 2/4 (50%)
FN3 <904..1195 CDD:442628 78/311 (25%)
FN3 906..1006 CDD:238020 28/106 (26%)
fn3 1221..1306 CDD:394996 14/86 (16%)
Ig 1336..1396 CDD:409353 6/15 (40%)
Ig strand B 1336..1340 CDD:409353 3/3 (100%)
Ig strand E 1371..1375 CDD:409353
Ig strand F 1385..1390 CDD:409353
FN3 <1407..>1606 CDD:442628
fn3 1408..1491 CDD:394996
Cntn5NP_446198.1 Ig 98..193 CDD:472250 22/79 (28%)
Ig strand B 119..123 CDD:409353 266/1077 (25%)
Ig strand C 132..136 CDD:409353 0/3 (0%)
Ig strand E 155..159 CDD:409353 1/3 (33%)
Ig strand F 170..175 CDD:409353 3/4 (75%)
Ig strand G 184..187 CDD:409353 0/2 (0%)
Ig 202..287 CDD:472250 24/92 (26%)
Ig strand B 213..217 CDD:409353 2/3 (67%)
Ig strand C 227..231 CDD:409353 1/3 (33%)
Ig strand E 252..256 CDD:409353 0/3 (0%)
Ig strand F 266..271 CDD:409353 2/4 (50%)
Ig strand G 282..285 CDD:409353 0/2 (0%)
Ig 300..387 CDD:472250 26/95 (27%)
Ig strand B 318..322 CDD:409353 0/3 (0%)
Ig strand C 331..335 CDD:409353 1/3 (33%)
Ig strand E 352..356 CDD:409353 1/3 (33%)
Ig strand F 366..371 CDD:409353 2/4 (50%)
Ig strand G 379..382 CDD:409353 1/3 (33%)
Ig 392..475 CDD:472250 25/93 (27%)
Ig strand B 407..411 CDD:143205 0/3 (0%)
Ig strand C 420..424 CDD:143205 1/3 (33%)
Ig strand E 441..445 CDD:143205 1/3 (33%)
Ig strand F 455..460 CDD:143205 2/4 (50%)
Ig strand G 468..471 CDD:143205 0/2 (0%)
Ig5_Contactin 480..568 CDD:409358 28/96 (29%)
Ig strand A 480..485 CDD:409358 1/4 (25%)
Ig strand A' 488..493 CDD:409358 0/4 (0%)
Ig strand B 497..504 CDD:409358 1/6 (17%)
Ig strand C 512..516 CDD:409358 1/3 (33%)
Ig strand D 530..533 CDD:409358 1/2 (50%)
Ig strand E 534..539 CDD:409358 3/4 (75%)
Ig strand F 547..555 CDD:409358 4/7 (57%)
Ig strand G 561..568 CDD:409358 1/6 (17%)
Ig 570..671 CDD:472250 20/104 (19%)
Ig strand B 589..593 CDD:409353 1/3 (33%)
Ig strand C 604..608 CDD:409353 0/3 (0%)
Ig strand E 633..637 CDD:409353 2/3 (67%)
Ig strand F 647..652 CDD:409353 2/4 (50%)
Ig strand G 660..663 CDD:409353 0/2 (0%)
FN3 667..>1060 CDD:442628 102/433 (24%)
FN3 671..768 CDD:238020 28/106 (26%)
FN3 878..969 CDD:238020 26/98 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 958..983 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.