DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and Robo4

DIOPT Version :10

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_001292144.1 Gene:Robo4 / 100911068 RGDID:6494870 Length:1021 Species:Rattus norvegicus


Alignment Length:1135 Identity:248/1135 - (21%)
Similarity:370/1135 - (32%) Gaps:410/1135 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 DAPPVLLYSFIEQTLQ-PGPAVSLKCSAAGNPTPQISWTLDGFP----------LPSNGRFMIGQ 473
            |:||.:|....:|.|| .||| .:.|.|:|.|.|.|.|.|:|.|          |.|:|..::.:
  Rat    39 DSPPQILVHPQDQLLQGSGPA-KMSCRASGQPLPTIRWLLNGQPLSMATPDLHYLQSDGTLLLHR 102

  Fly   474 YITVHGDVISHVNISHVMVEDGGEYACIAENRAG-RVQHAARLNIYGLPY-IRLIPKVT-AVSGE 535
            ..| ||......||...::   |.|.|.|.||.| .|...|||::..|.. .|:.|:.| ||.||
  Rat   103 PPT-HGRPQDDQNILSAIL---GVYTCEASNRLGTAVSRGARLSVAVLQEDFRIQPRDTVAVVGE 163

  Fly   536 TLNLKC-PVAGYPIEEIHWERGGRELPDDIRQRVQPDGSLTISPVQKNSDSGVYTCWARNKQGHS 599
            :|.|:| |..|||...:.|.:.|:.|.....:|.....||.::..:|| |:|.|.|.|.|..|..
  Rat   164 SLVLECGPPWGYPKPSVSWWKDGKPLVLQPGKRTVSGDSLMVARAEKN-DTGTYMCMATNNAGQR 227

  Fly   600 ARRSGEVTVIVPPKLSPFQTNILQL-----NMGDRASLTCSVVKGDLP---LTINWRKDGRPIDP 656
            ..|:..|::    :.||.....|:|     .:.:...|....|||..|   :.::|:..| |..|
  Rat   228 ESRAARVSI----QESPDHKEHLELLAVRIQLENVTLLNPEPVKGPKPGPAVWLSWKVSG-PAAP 287

  Fly   657 TQHMSV---------KQVDQYNSILVIENLGSDHTG-----NYSCVVRNSA--AEVENSQALLVN 705
            .|..:.         .|...:..:|:...|.:...|     :|...||.|:  |...:|..||:.
  Rat   288 AQSYTALFRAQRDPRDQGSPWTEVLLDGLLNAKLGGLRWGQDYEFKVRPSSGRARGPDSNVLLLR 352

  Fly   706 VPPRWIVEPVDANVERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLGNGSLL 770
            :|                        :.||             |...:||..||     ||||:.
  Rat   353 LP------------------------EQVP-------------SAPPQEVTLRP-----GNGSVF 375

  Fly   771 LQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGDKPI 835
            :.......|.      :||...|..                                        
  Rat   376 VSWAPPPAEN------HNGFIRGYQ---------------------------------------- 394

  Fly   836 NIVWMRSGKNTLNPSTNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQQLVQL 900
              ||  |..|...|:.|:        |..|...:|:|.   |...|.|..:.:.:.|       .
  Rat   395 --VW--SLGNASLPAANW--------TVVGEQTQLEIA---ARMPGSYCVQVAAVTG-------A 437

  Fly   901 QVQEPPLPPS-VLEAAMISSR---SVNIKW----------QPKTLGTGDVTKY---------IVE 942
            ...||.:|.. :||.||..|.   |.::.|          :|:.:.:|.|..:         |..
  Rat   438 GAGEPSIPVCLLLEQAMEQSARDPSKHVSWTLEQLRATLKRPEVIASGAVLLWLLLLGIAVCIYR 502

  Fly   943 FREADHSLPPALF---------------------VDQWQQ------------------IEVKDPP 968
            .|:|...|.|.|:                     .|.|:.                  ::.:||.
  Rat   503 RRKAGVHLGPGLYRYTSEDAILKHRMDHSDSPWLADTWRSTSGSRDLSSSSSLSSRLGVDPRDPL 567

  Fly   969 HFNAMIENLKP-----------ATRYAFRVIAEGSAGRSAPSQELIVRTEPQRPAG----PPLSL 1018
            .....:.:..|           :|.|. .:|||.:   |:|.    ||..||.||.    |.|:.
  Rat   568 DGRRSLISWDPRSPGVPLLPDTSTFYG-SLIAEQT---SSPP----VRPSPQTPAARRLPPKLTG 624

  Fly  1019 SARPLSSTELLIS----------------WVA------------PLPELRHG-DIQGYNVGYKLS 1054
            ::.|.:|::.|.|                |.|            ||....|. :|..:.:|.:.|
  Rat   625 TSSPWASSDSLCSRRGLCSPRMSLAPAEAWKAKKKQELHQANSSPLLRGSHPMEIWAWELGSRAS 689

  Fly  1055 SSGNTAYNFTSVSGDGDGGNGELLLSGLAKFARYTVVVQAFNQVGP-----------GPLSEPTA 1108
            .      |.:...|.......|         |...||  |:..:||           .||  |..
  Rat   690 K------NLSQSPGPNTCSPRE---------APGAVV--AWRALGPQLHRNSSELAARPL--PPT 735

  Fly  1109 AQTMEDVPSRPPEDVRCA----ALSSQSL----------------QVSWQPPPIYHTNGLLQGYK 1153
            ..::...||..|:. :|.    |.||..|                |.|:...|...::.|.....
  Rat   736 PLSLRGAPSHDPQS-QCVEKLQAPSSDPLPAAPLSVLNSSRPSSPQASFLSVPSPGSSNLSSSSL 799

  Fly  1154 LIFEPIIDDIQPSKDEVESRKTTALTMVLTGLRKYTNYSIQVLAHT------------------- 1199
            ...|      :..:|.|.:.:..||.:.|:...:....|:..:...                   
  Rat   800 SSLE------EEDQDSVLTPEEVALCLELSDGEETPTNSVSPMPRAPSPPATYGYISIPTSSGLA 858

  Fly  1200 ---RMGDGVVSK-------PLFC----------------HSEEDVPEAPADIKVVSSSSQSLYIS 1238
               |.|.||.|:       |..|                .||::||.|.|.:  ||||..|....
  Rat   859 DMGRAGGGVGSEVGNLLCPPRLCPTPTPSEGSLANGWGSASEDNVPSARASL--VSSSDGSFLAD 921

  Fly  1239 ----------------WLPPNEPNGVITKYSLYTRVVNGREELN-NEKRSLPSQQAYYEAKGLHP 1286
                            .|.|.|.:.|.|..|   ...:.|::|: ....|||..:       ..|
  Rat   922 AHFARALAVAVDSFGFSLEPREADCVFTDAS---SPPSPRDDLSLTRSFSLPLWE-------WRP 976

  Fly  1287 HMEYQFWVTASTRVGEG-----KSSRVSSQ 1311
            .......:..:.|:|.|     ..||||||
  Rat   977 DWLEDAEINHTQRLGRGLPPWPPDSRVSSQ 1006

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 30..128 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand E 86..90 CDD:409353
Ig strand F 106..111 CDD:409353
Ig strand G 119..123 CDD:409353
V-set 138..229 CDD:462230
Ig 238..327 CDD:472250
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 293..297 CDD:409353
Ig strand F 307..312 CDD:409353
Ig strand G 320..323 CDD:409353
Ig 330..418 CDD:472250
Ig strand B 348..352 CDD:409353
Ig strand C 365..369 CDD:409353
Ig strand E 383..387 CDD:409353
Ig strand F 397..402 CDD:409353
Ig strand G 411..414 CDD:409353
IgI_4_Dscam 422..517 CDD:409548 38/106 (36%)
Ig strand A 422..425 CDD:409548 2/2 (100%)
Ig strand A' 431..435 CDD:409548 1/3 (33%)
Ig strand B 438..447 CDD:409548 3/8 (38%)
Ig strand C 452..458 CDD:409548 3/5 (60%)
Ig strand C' 460..463 CDD:409548 2/12 (17%)
Ig strand D 468..476 CDD:409548 0/7 (0%)
Ig strand E 480..489 CDD:409548 2/8 (25%)
Ig strand F 496..504 CDD:409548 4/7 (57%)
Ig strand G 507..517 CDD:409548 5/10 (50%)
IgI_5_Dscam 521..608 CDD:409550 31/89 (35%)
Ig strand A 521..523 CDD:409550 0/2 (0%)
Ig strand A' 528..532 CDD:409550 1/4 (25%)
Ig strand B 535..542 CDD:409550 4/7 (57%)
Ig strand C 549..555 CDD:409550 1/5 (20%)
Ig strand C' 556..558 CDD:409550 0/1 (0%)
Ig strand D 565..569 CDD:409550 1/3 (33%)
Ig strand E 572..578 CDD:409550 2/5 (40%)
Ig strand F 586..594 CDD:409550 4/7 (57%)
Ig strand G 598..608 CDD:409550 2/9 (22%)
Ig 611..704 CDD:472250 25/116 (22%)
Ig strand B 630..634 CDD:409353 1/3 (33%)
Ig strand C 644..648 CDD:409353 0/3 (0%)
Ig strand E 670..674 CDD:409353 1/3 (33%)
Ig strand F 684..689 CDD:409353 1/4 (25%)
Ig strand G 697..700 CDD:409353 0/2 (0%)
IgI_7_Dscam 707..802 CDD:409546 16/94 (17%)
Ig strand A 707..711 CDD:409546 1/3 (33%)
Ig strand A' 716..720 CDD:409546 0/3 (0%)
Ig strand B 723..732 CDD:409546 0/8 (0%)
Ig strand C 738..744 CDD:409546 0/5 (0%)
Ig strand C' 750..753 CDD:409546 0/2 (0%)
Ig strand D 761..764 CDD:409546 0/2 (0%)
Ig strand E 767..773 CDD:409546 2/5 (40%)
Ig strand F 780..788 CDD:409546 0/7 (0%)
Ig strand G 793..802 CDD:409546 1/8 (13%)
Ig 806..892 CDD:472250 13/85 (15%)
Ig strand B 823..827 CDD:409353 0/3 (0%)
Ig strand C 836..840 CDD:409353 1/3 (33%)
Ig strand E 868..872 CDD:409353 1/3 (33%)
Ig strand F 882..887 CDD:409353 1/4 (25%)
FN3 <904..1195 CDD:442628 82/427 (19%)
FN3 906..1006 CDD:238020 30/172 (17%)
fn3 1221..1306 CDD:394996 22/106 (21%)
Ig 1336..1396 CDD:409353
Ig strand B 1336..1340 CDD:409353
Ig strand E 1371..1375 CDD:409353
Ig strand F 1385..1390 CDD:409353
FN3 <1407..>1606 CDD:442628
fn3 1408..1491 CDD:394996
Robo4NP_001292144.1 Ig 42..144 CDD:472250 37/106 (35%)
Ig strand B 59..63 CDD:409490 1/4 (25%)
Ig strand C 72..76 CDD:409490 1/3 (33%)
Ig strand E 96..100 CDD:409490 1/3 (33%)
Ig strand F 122..127 CDD:409490 2/4 (50%)
Ig strand G 136..139 CDD:409490 0/2 (0%)
Ig 151..236 CDD:472250 31/85 (36%)
Ig strand B 165..169 CDD:409389 2/3 (67%)
Ig strand C 179..183 CDD:409389 0/3 (0%)
Ig strand E 201..205 CDD:409389 2/3 (67%)
Ig strand F 215..220 CDD:409389 2/4 (50%)
Ig strand G 229..232 CDD:409389 1/2 (50%)
fn3 361..443 CDD:394996 27/154 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 544..563 0/18 (0%)
PHA03247 <578..861 CDD:223021 59/316 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 600..634 12/40 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 726..810 17/92 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.